LXL04_030358 | RubberDandelionOmics

Gene overview

LXL04_030358

Reference: OH-1004 Chr: Chr06 Coordinates: 114875229-114876596 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1368 bp · LXL04_030358|LXL04_030358|OH1004|cDNA

ATGACTTCTTTTACAGAAGTTAAACGCATTTCAGAGTGCTTCGTAAAGCCACTGCGTGACCTCTCGCCGGAGGCAAAGCAGCCTTTTTACTTCACACCCTTCGAGCTGCCCTGCCTCAACATCAACTACAGCCAAAAGGGTCTCCTCTTTTCAAAGCCACCACCGTCGGAAAATCAAGATTTCTCCATAACCGATTACTTAGATGACCTCCGACACTCCCTCTCCACCACCCTCGATCATTTCTACCCGCTCGCCGGCCG...

CDS

Download CDS FASTA

1368 bp · LXL04_030358|LXL04_030358|OH1004|CDS

ATGACTTCTTTTACAGAAGTTAAACGCATTTCAGAGTGCTTCGTAAAGCCACTGCGTGACCTCTCGCCGGAGGCAAAGCAGCCTTTTTACTTCACACCCTTCGAGCTGCCCTGCCTCAACATCAACTACAGCCAAAAGGGTCTCCTCTTTTCAAAGCCACCACCGTCGGAAAATCAAGATTTCTCCATAACCGATTACTTAGATGACCTCCGACACTCCCTCTCCACCACCCTCGATCATTTCTACCCGCTCGCCGGCCG...

Protein

Download Protein FASTA

455 aa · LXL04_030358|LXL04_030358|OH1004|PROTEIN

MTSFTEVKRISECFVKPLRDLSPEAKQPFYFTPFELPCLNINYSQKGLLFSKPPPSENQDFSITDYLDDLRHSLSTTLDHFYPLAGRLATRKEENPPSYVIYLDPGNTSGVKFIHATADATVSDILQPGDVPLVVRSFFDLNNAISHDAHTLPLLSIQVTELVDGIFIGGSVNHMVADGTSFWHFMGAWSEIFKSKEQYCGTISRPPVFKRWVLDGFDPIINLPFTHHDQFIERFEPPQFRERFFHFSAAAVSKLKKKAN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030358`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030358

Location Chr06:114875229-114876596 (-)

Description Similar to At3g50280: Uncharacterized acetyltransferase At3g50280

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50280`	Uncharacterized acetyltransferase At3g50280.	No verified direct reference in this release
`At5g67160`	Required for pathogen-induced salicylic acid (SA) accumulation and SA-mediated resistance to virulent and avirulent pathogens (e.g. P.syringae).	An important role of a BAHD acyl transferase-like protein in plant innate immunity.2009 · DOI: 10.1111/j.1365-313x.2008.03747.x
`At5g23940`	Required for incorporation of 9(10),16-dihydroxy-hexadecanoic acid into cutin.	No verified direct reference in this release
`At5g48930`	Acyltransferase involved in the biosynthesis of lignin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030358 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009697 salicylic acid biosynthetic process Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0009963 positive regulation of flavonoid biosynthetic process Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0090626 plant epidermis morphogenesis Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

KEGG gene cross-reference

ag:CAB06427

ath:AT3G50280

ath:AT5G23940

ath:AT5G48930

ath:AT5G67160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.721

Rank 1 · LXL04_030358 · OH-1004

Nucleus0.324

Rank 2 · LXL04_030358 · OH-1004

Endoplasmic reticulum0.083

Rank 3 · LXL04_030358 · OH-1004

Cell membrane0.075

Rank 4 · LXL04_030358 · OH-1004

Plastid0.039

Rank 5 · LXL04_030358 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458.21Transferase39-447 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030358	`PF02458.21`	Transferase	39	447	2.4e-67	228.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SND9`	Arabidopsis thaliana	Uncharacterized acetyltransferase At3g50280	37.389%	Swiss-Prot	moderate database homology
`Q9FH97`	Arabidopsis thaliana	Protein ENHANCED PSEUDOMONAS SUSCEPTIBILITY 1	36.047%	Swiss-Prot	moderate database homology
`Q9FF86`	Arabidopsis thaliana	BAHD acyltransferase DCR	33.689%	Swiss-Prot	moderate database homology
`Q9FI78`	Arabidopsis thaliana	Shikimate O-hydroxycinnamoyltransferase	26.343%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card