TkA07G397580 | RubberDandelionOmics

Gene overview

TkA07G397580

Reference: TK1151 Chr: Chr07 Coordinates: 99908152-99910417 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1995 bp · TkA07G397580|TK1151|cDNA

CCCCCTAATACATGCCAATTTGATGATATTTGGTCGTCATTCCAACATAGCATTCCTATTGTTTCATGAAAGATATTTTGAACTCTTTCTCAAATCTCGCTCTCGTTTGACTATTATTGATGGTTTTGTCTTGTGAAATCGAAACCCACAACGTTGCTAAAGCCTTTTATTAATCGAGTGCCCACTTAATCTTTGTAGAGGTGGTGGGTTTATTCTTTGCGTTTGTCGGCTCCGATATAATCATCTATTTCTTCTTTGCT...

CDS

Download CDS FASTA

963 bp · TkA07G397580|TK1151|CDS

ATGGCGGCTCTTCCTCTTTCCAATCATCACTCTCTCTGCGCTCCTCGCCTTGTCGACGCATCTATTTTCAAATCCTCGCAATTTAGAACACAAAATCTCGCTTTTCAGTCCTACCCACACCTTCATAGTCGGCATTCTTCTAAACCCCTTTTAGGGCTTTCTCGATCTCTTCCTAATTCATATACGGGTAAAAGTTGGCGTTCCTTCAAATCCCTGTGCACAGCCAAGGACACTACTGTTAAGACAAGCGAAGACGATGC...

Protein

Download Protein FASTA

320 aa · TkA07G397580|TK1151|PROTEIN

MAALPLSNHHSLCAPRLVDASIFKSSQFRTQNLAFQSYPHLHSRHSSKPLLGLSRSLPNSYTGKSWRSFKSLCTAKDTTVKTSEDDALEESETDSDNETTLTVNSLLQLYKQSILNNDTTTISDIESTLNHIEEQKNKLSEQVTSLLSETTSGKEKYIRLQADFDNYRKRSEKERINVRSNAQGEVIESLLPMVDNFERAKQQLKLETDQEKKIDASYQGIYKQFVEIMRSLRVAAVPTVGKPFDPSVHEAIAREESMEF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G397580`
TK1151 ID	TkA07G397580
OH-1004 ID	LXL04_030329
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G397580`
Location	Chr07:99908152-99910417 (+)
Description	Similar to grpE: Protein GrpE (Prochlorococcus marinus (strain MIT 9303)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030329` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0005737 cytoplasm Cellular Component GO:0000774 adenyl-nucleotide exchange factor activity Molecular Function GO:0042803 protein homodimerization activity Molecular Function GO:0051082 unfolded protein binding Molecular Function GO:0051087 protein-folding chaperone binding Molecular Function
KEGG gene cross-reference	pmf:P9303_00201 pmj:P9211_00161 syd:Syncc9605_0023 sye:Syncc9902_0019 tel:tlr1314 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.966

Rank 1 · TkA07G397580 · TK1151

Mitochondrion0.043

Rank 2 · TkA07G397580 · TK1151

Nucleus0.032

Rank 3 · TkA07G397580 · TK1151

Cytoplasm0.032

Rank 4 · TkA07G397580 · TK1151

Peroxisome0.018

Rank 5 · TkA07G397580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10168Nup8879-222 aa

PF02472ExbD90-163 aa

PF05478Prominin93-154 aa

PF01895PhoU103-150 aa

PF10303DUF2408107-232 aa

PF06103DUF948118-152 aa

PF06419COG6_N119-156 aa

PF01025GrpE131-288 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G397580	`PF10168`	Nup88	79	222	0.057	12.0
TkA07G397580	`PF02472`	ExbD	90	163	2.4	9.0
TkA07G397580	`PF05478`	Prominin	93	154	7.9	5.1
TkA07G397580	`PF01895`	PhoU	103	150	0.75	10.9
TkA07G397580	`PF10303`	DUF2408	107	232	0.62	11.4
TkA07G397580	`PF06103`	DUF948	118	152	0.081	13.8
TkA07G397580	`PF06419`	COG6_N	119	156	0.03	15.2
TkA07G397580	`PF01025`	GrpE	131	288	2e-40	138.9
TkA07G397580	`PF01361`	Tautomerase	133	151	0.15	12.7
TkA07G397580	`PF01895`	PhoU	145	199	0.75	10.9
TkA07G397580	`PF02472`	ExbD	160	239	2.4	9.0
TkA07G397580	`PF06419`	COG6_N	168	225	0.03	15.2
TkA07G397580	`PF05478`	Prominin	176	232	7.9	5.1
TkA07G397580	`PF01895`	PhoU	209	230	0.75	10.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card