Gene Card
Gene overview
cDNA / CDS / Protein Sequences
963 bp · LXL04_030329|LXL04_030329|OH1004|cDNA
ATGGCCGCTCTTCCTCTTTCCAATCATCACTCTCTCTGCGCTCCTCGCCTTGTCGACGCATCTATTTTCAAATCCTCGCAATTTAGAACACAAAATCTCGCTTTTCAGTCCTACCCACACCTTCATAGTCGGCATTCTTCTAAACCCCTTTTAGGGCTTTCTCGATCTCTTCCTAATTCATATACGGGTAAAAGTTGGCGTTCCTTCAAATCCCTGTGCACAGCCAAGGACACTACTGTTAAGACAAGCGAAGACGATGC...
963 bp · LXL04_030329|LXL04_030329|OH1004|CDS
ATGGCCGCTCTTCCTCTTTCCAATCATCACTCTCTCTGCGCTCCTCGCCTTGTCGACGCATCTATTTTCAAATCCTCGCAATTTAGAACACAAAATCTCGCTTTTCAGTCCTACCCACACCTTCATAGTCGGCATTCTTCTAAACCCCTTTTAGGGCTTTCTCGATCTCTTCCTAATTCATATACGGGTAAAAGTTGGCGTTCCTTCAAATCCCTGTGCACAGCCAAGGACACTACTGTTAAGACAAGCGAAGACGATGC...
Protein
Download Protein FASTA320 aa · LXL04_030329|LXL04_030329|OH1004|PROTEIN
MAALPLSNHHSLCAPRLVDASIFKSSQFRTQNLAFQSYPHLHSRHSSKPLLGLSRSLPNSYTGKSWRSFKSLCTAKDTTVKTSEDDALEESETDSDNETTLTVNSLLQLYKQSILNNDTTTISDIESTLNHIEEQKNKLSEQVTSLLSETTSGKEKYIRLQADFDNYRKRSEKERINVRSNAQGEVIGSLLPMVDNFERAKQQLKLETDQEKKIDASYQGIYKQFVEIMRSLRVAAVPTVGKPFDPSVHEAIAQEESMEF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_030329 |
|---|---|
| TK1151 ID | TkA07G397580 |
| OH-1004 ID | LXL04_030329 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_030329 |
|---|---|
| Location | Chr06:114369144-114370377 (+) |
| Description | Similar to grpE: Protein GrpE (Prochlorococcus marinus (strain MIT 9303) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006457 protein folding Biological Process GO:0005737 cytoplasm Cellular Component GO:0000774 adenyl-nucleotide exchange factor activity Molecular Function GO:0042803 protein homodimerization activity Molecular Function GO:0051082 unfolded protein binding Molecular Function GO:0051087 protein-folding chaperone binding Molecular Function |
| KEGG gene cross-reference | pmf:P9303_00201 pmj:P9211_00161 syd:Syncc9605_0023 sye:Syncc9902_0019 tel:tlr1314 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01025.25GrpE131-288 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_030329 | PF01025.25 | GrpE | 131 | 288 | 1.6e-40 | 139.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.