RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G392350
Reference: TK1151 Chr: Chr07 Coordinates: 98478426-98481745 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2197 bp · TkA07G392350|TK1151|cDNA

AATTGGGCCTTGAAATGTTCTCAAAGGCTAAGAGCCGTTTCTTTTTTTGTTTTTAATTTTGGCATCATATTTGCTGGATTTTAACTTTTTAAGTTTAAATTTACAAATGAAAAAAGCAAAACAAACAAAAAAGAAGTACGTGGGTGACTGGGTGGGGCCTTTGTATTTTTCAAAATTTGCTTTATTCAGTTTACCACCTCATTATCGCCTATTTCCAGCCAGGCTTAAAGCAAGAAAGAGAGAGAGAAGGGCTGACGGGT...

CDS

Download CDS FASTA

1554 bp · TkA07G392350|TK1151|CDS

ATGGCGGATCGCTTAATGCTTGCTTCTATTTTCGTTTCCGTTGTCGGACTTATACTCTTTTGGATCTCTATTCTCATTAAAAATGGACGCCCACACAAATCCGCATCTGTCACGACCAAATCAACCTCGATCAGCACAGAATGCAGATCCGGAGACGAAACCGACGTCATTATCGTCGGCGCCGGTGTTGCCGGTGCTGCCCTCGCCCATACTCTCGCCAAGGATGGACGCCGTGTACTAGTGATTGAAAGAGACCTAAC...

Protein

Download Protein FASTA

517 aa · TkA07G392350|TK1151|PROTEIN

MADRLMLASIFVSVVGLILFWISILIKNGRPHKSASVTTKSTSISTECRSGDETDVIIVGAGVAGAALAHTLAKDGRRVLVIERDLTEPDRIVGELLQPGGYLKLMELGLEDCVEDIDAQRVFGYALFKDGKNTRLSYPLEKFHADVAGRSFHNGRFIQKMREKASSLPTIRLQQGTVVSLLEEEGTIKGALYKTKNGKEMKAFAPLTIVCDGCFSNLRRSLCNPQVDVPSCFVGLILENCNLPYENHGHVVLADPSPIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G392350
TK1151 IDTkA07G392350
OH-1004 IDLXL04_001469
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)79.700
Protein coverage (%)TK1151 89.362 / OH-1004 86.517
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G392350
LocationChr07:98478426-98481745 (-)
DescriptionSimilar to SQE1: Squalene monooxygenase SE1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g58440 May catalyze stereospecific oxidation of squalene to (S)-2,3-epoxysqualene in sterol biosynthesis.
Arabidopsis thaliana squalene epoxidase 1 is essential for root and seed development.2007 · DOI: 10.1074/jbc.m611831200
Identification of the Arabidopsis dry2/sqe1-5 mutant reveals a central role for sterols in drought tolerance and regulation of reactive oxygen species.2009 · DOI: 10.1111/j.1365-313x.2009.03849.x
Analysis of the arabidopsis dry2/sqe1-5 mutant suggests a role for sterols in signaling.2009 · DOI: 10.4161/psb.4.9.9425
At4g37760 May catalyze stereospecific oxidation of squalene to (S)-2,3-epoxysqualene in sterol biosynthesis.
Arabidopsis thaliana squalene epoxidase 1 is essential for root and seed development.2007 · DOI: 10.1074/jbc.m611831200
At2g22830 Catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene, and is considered to be a rate-limiting enzyme in steroid biosynthesis.
Arabidopsis thaliana squalene epoxidase 1 is essential for root and seed development.2007 · DOI: 10.1074/jbc.m611831200

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_001469 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002238 response to molecule of fungal origin Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009611 response to wounding Biological Process
GO:0009723 response to ethylene Biological Process
GO:0009725 response to hormone Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0009753 response to jasmonic acid Biological Process
GO:0010038 response to metal ion Biological Process
GO:0016126 sterol biosynthetic process Biological Process
GO:0042542 response to hydrogen peroxide Biological Process
GO:0046246 terpene biosynthetic process Biological Process
GO:0071731 response to nitric oxide Biological Process
KEGG gene cross-reference
ath:AT1G58440
ath:AT2G22830
ath:AT4G37760
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.398
Rank 1 · TkA07G392350 · TK1151
Mitochondrion0.154
Rank 2 · TkA07G392350 · TK1151
Cytoplasm0.130
Rank 3 · TkA07G392350 · TK1151
Golgi apparatus0.121
Rank 4 · TkA07G392350 · TK1151
Cell membrane0.108
Rank 5 · TkA07G392350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01946Thi452-87 aa
PF01488Shikimate_DH52-107 aa
PF00996GDI52-85 aa
PF01494FAD_binding_353-364 aa
PF01262AlaDh_PNT_C53-87 aa
PF01266DAO55-85 aa
PF00890FAD_binding_255-84 aa
PF01134GIDA55-217 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G392350PF01946Thi452878.2e-0522.7
TkA07G392350PF01488Shikimate_DH521070.02415.4
TkA07G392350PF00996GDI52850.3210.2
TkA07G392350PF01494FAD_binding_3533641.4e-1868.0
TkA07G392350PF01262AlaDh_PNT_C53870.2311.6
TkA07G392350PF01266DAO55855.2e-1143.4
TkA07G392350PF00890FAD_binding_255841e-0628.9
TkA07G392350PF01134GIDA552179.3e-0625.7
TkA07G392350PF07992Pyr_redox_255853.3e-0524.2
TkA07G392350PF12831FAD_oxidored55850.0003120.9
TkA07G392350PF05834Lycopene_cycl55830.002217.8
TkA07G392350PF03486HI0933_like55850.003917.4
TkA07G392350PF02254TrkA_N56860.007517.3
TkA07G392350PF00070Pyr_redox56840.01816.2
TkA07G392350PF03435Sacchrp_dh_NADP56950.04414.8
TkA07G392350PF027373HCDH_N56870.09213.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SM02Arabidopsis thalianasp|Q9SM02|ERG14_ARATH Squalene epoxidase 174.700%Swiss-ProtHigh
Q8VYH2Arabidopsis thalianasp|Q8VYH2|ERG16_ARATH Squalene epoxidase 378.500%Swiss-ProtHigh
O81000Arabidopsis thalianasp|O81000|ERG15_ARATH Squalene epoxidase 2, mitochondrial77.400%Swiss-ProtHigh

JBrowse

View in Genome Browser