TkA07G372820 | RubberDandelionOmics

Gene overview

TkA07G372820

Reference: TK1151 Chr: Chr07 Coordinates: 93527488-93529574 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1979 bp · TkA07G372820|TK1151|cDNA

TCAACAAATTTTTTAATTTCAAAATGAGGTGGATTGATTGTACGTACTGCTGGAGCACCATTATAAATAGATAGGTTGATATCATTGCTAAGCAAACACCACAAAGAGAAAAACCCATTGAGTCATTGACATGGACATCTTCACTTTCTTCCCTTCATGGCTTTTTTCATCGGTATCAATTCTAATCTTTTCTTTAATCTTCGTATACGCTTTACGAAGGAAGAAACCATCATCCAAGGCTGCCCCAAACCTCCCCCCCA...

CDS

Download CDS FASTA

1494 bp · TkA07G372820|TK1151|CDS

ATGGACATCTTCACTTTCTTCCCTTCATGGCTTTTTTCATCGGTATCAATTCTAATCTTTTCTTTAATCTTCGTATACGCTTTACGAAGGAAGAAACCATCATCCAAGGCTGCCCCAAACCTCCCCCCCAGCCCTCCGACGCTTCCGATAATAGGAAACCTGCATCAAGTGATTGGTAAAAACTTCCATCAAATCCTTTGGAAAGTCTCCCGTCAATACGGCCCTATTATGACTGTCCATTTAGGTGCCACACCATACGT...

Protein

Download Protein FASTA

497 aa · TkA07G372820|TK1151|PROTEIN

MDIFTFFPSWLFSSVSILIFSLIFVYALRRKKPSSKAAPNLPPSPPTLPIIGNLHQVIGKNFHQILWKVSRQYGPIMTVHLGATPYVIISSSEFANQALKTHDQILCNRPRSKGFQRLTFDYMDVAFSPHAEQWKEMRKVLVNEFLGSKRSKLFKKVVDAEVKGMLDSFSSEHLNTTVNMDERLFHLVTDIVSKVAVGKSYREVTFRGKKLKEMLDDLVISLCGSVSDIYPGRIGLILDEILGFNRRLEKTFSTFDAFLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G372820`
TK1151 ID	TkA07G372820
OH-1004 ID	LXL04_030046
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 92.958 / OH-1004 84.771 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G372820

Location Chr07:93527488-93529574 (-)

Description Similar to CYP71CA1: Parthenolide synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26300`	Cytochrome P450 71B34.	No verified direct reference in this release
`At3g26330`	Cytochrome P450 71B37.	No verified direct reference in this release
`At1g13080`	Cytochrome P450 71B2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030046 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0051762 sesquiterpene biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen Molecular Function

GO:0020037 heme binding Molecular Function

GO:0102626 parthenolide synthase activity Molecular Function

GO:0106244 eupatolide synthase activity Molecular Function

KEGG gene cross-reference

ath:AT3G26300

ath:AT3G26320

ath:AT3G26330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.926

Rank 1 · TkA07G372820 · TK1151

Cell membrane0.044

Rank 2 · TkA07G372820 · TK1151

Cytoplasm0.039

Rank 3 · TkA07G372820 · TK1151

Plastid0.028

Rank 4 · TkA07G372820 · TK1151

Golgi apparatus0.022

Rank 5 · TkA07G372820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45042-478 aa

PF12943DUF3839119-228 aa

PF16872putAbiC276-302 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G372820	`PF00067`	p450	42	478	2e-89	301.2
TkA07G372820	`PF12943`	DUF3839	119	228	0.041	14.1
TkA07G372820	`PF16872`	putAbiC	276	302	0.031	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIP6`	Arabidopsis thaliana	sp\|Q9LIP6\|C71BV_ARATH Cytochrome P450 71B34	40.200%	Swiss-Prot	Medium
`Q9LIP3`	Arabidopsis thaliana	sp\|Q9LIP3\|C71BY_ARATH Cytochrome P450 71B37	39.900%	Swiss-Prot	Medium
`O65788`	Arabidopsis thaliana	sp\|O65788\|C71B2_ARATH Cytochrome P450 71B2	38.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card