TkA07G351210 | RubberDandelionOmics

Gene overview

TkA07G351210

Reference: TK1151 Chr: Chr07 Coordinates: 87745803-87750051 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3134 bp · TkA07G351210|TK1151|cDNA

GGAACATTTTGGAGTAAACGGGCGGGAAAACATGGAACATCCAAAATTCTCAAAACCCTAACTCCTACATCATTTTCGCGCTTCACCTCTCCGCTCATTTCTGCAATTTCCTACAAATCGATCTCGAGAAAAAACATTCCAACGTTTCTCGATCTGATATCACGTTCGTCAATCCGCCACAAATATTAATCCTGAATTTGTAGAGACGCTGAATTGTAGATCTGAACAGTGTCAATGGAAAGTCGGATGGTGCTACACGC...

CDS

Download CDS FASTA

2652 bp · TkA07G351210|TK1151|CDS

ATGGAAAGTCGGATGGTGCTACACGCGCCTGATGAAGTTATTACCGAGCTTACCGGTGCCGACACTGAGTTAGTGAGCAGATCATGGAACTTATTTGCTATACTGCTATCCTTAGGGCATCCAGTTCTTCCTATTGAACTGGCATCTCGATGCACTTCTTTTGAAGTGTCAACGGAATTTGTCGAATTCGTTTGTTCTATACCTAACTCTCCCCTCTCGCTGACGGATGATGGTTTGGTTACGATTTCTTCTGCTGTTTG...

Protein

Download Protein FASTA

883 aa · TkA07G351210|TK1151|PROTEIN

MESRMVLHAPDEVITELTGADTELVSRSWNLFAILLSLGHPVLPIELASRCTSFEVSTEFVEFVCSIPNSPLSLTDDGLVTISSAVCMRLQRFLLSSGRLFKISIPREIETRDCERKRACGDVELMYYRKRKRSRPNISDNADQTALAMPVRISDAFEKVYAHDDDHALRSLIITNDNIPVEGTINMSALINFDGGLLTTGLNDCKDEDENDSTTVLSTKELAIQNNFLNGFICFPSPIKTQSRKRKDCSQFQPSSHLTA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G351210`
TK1151 ID	TkA07G351210
OH-1004 ID	LXL04_029833
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G351210`
Location	Chr07:87745803-87750051 (+)
Description	Similar to CDC7: Cell division cycle 7-related protein kinase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029833` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000076 DNA replication checkpoint signaling Biological Process GO:0000082 G1/S transition of mitotic cell cycle Biological Process GO:0000727 double-strand break repair via break-induced replication Biological Process GO:0006270 DNA replication initiation Biological Process GO:0007165 signal transduction Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0010571 positive regulation of nuclear cell cycle DNA replication Biological Process GO:0010971 positive regulation of G2/M transition of mitotic cell cycle Biological Process GO:0031573 mitotic intra-S DNA damage checkpoint signaling Biological Process GO:0033314 mitotic DNA replication checkpoint signaling Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0044770 cell cycle phase transition Biological Process
KEGG gene cross-reference	ddi:DDB_G0292152 dme:Dmel_CG5790 hsa:8317 spo:2541165 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.889

Rank 1 · TkA07G351210 · TK1151

Cytoplasm0.155

Rank 2 · TkA07G351210 · TK1151

Cell membrane0.036

Rank 3 · TkA07G351210 · TK1151

Mitochondrion0.024

Rank 4 · TkA07G351210 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA07G351210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase307-336 aa

PF07714PK_Tyr_Ser-Thr307-337 aa

PF03109ABC1434-474 aa

PF00069Pkinase440-582 aa

PF07714PK_Tyr_Ser-Thr441-582 aa

PF01636APH539-577 aa

PF06293Kdo539-576 aa

PF03109ABC1541-584 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G351210	`PF00069`	Pkinase	307	336	2.3e-46	159.0
TkA07G351210	`PF07714`	PK_Tyr_Ser-Thr	307	337	2.7e-14	53.8
TkA07G351210	`PF03109`	ABC1	434	474	0.0007	19.5
TkA07G351210	`PF00069`	Pkinase	440	582	2.3e-46	159.0
TkA07G351210	`PF07714`	PK_Tyr_Ser-Thr	441	582	2.7e-14	53.8
TkA07G351210	`PF01636`	APH	539	577	0.00077	20.0
TkA07G351210	`PF06293`	Kdo	539	576	0.027	14.6
TkA07G351210	`PF03109`	ABC1	541	584	0.0007	19.5
TkA07G351210	`PF07714`	PK_Tyr_Ser-Thr	717	850	2.7e-14	53.8
TkA07G351210	`PF00069`	Pkinase	723	860	2.3e-46	159.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card