TkA07G348130 | RubberDandelionOmics

Gene overview

TkA07G348130

Reference: TK1151 Chr: Chr07 Coordinates: 86996033-86996669 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

441 bp · TkA07G348130|TK1151|cDNA

AAAAAATTGATTCAAAACGCGGTGATACAAAAAAATTCAGAGTGTGAAGCGGTTTCAATTTTCAGTCAATTAATTGAATCGATCAGTTATTGTCATAGATTAGGCATTGCGCATCGGGATATTAAACGGGATAATGCTTTGTTTGATTCGACAGGGAAATTGAAGTTGGCGGACTTCGGATCGGCGGAGTGGTTTGGGATGAATGAGCGTGGTTCGATGACCGGAGTTGTTGGCACGCCGTACTATGTTGCACCAGAGGT...

CDS

Download CDS FASTA

441 bp · TkA07G348130|TK1151|CDS

AAAAAATTGATTCAAAACGCGGTGATACAAAAAAATTCAGAGTGTGAAGCGGTTTCAATTTTCAGTCAATTAATTGAATCGATCAGTTATTGTCATAGATTAGGCATTGCGCATCGGGATATTAAACGGGATAATGCTTTGTTTGATTCGACAGGGAAATTGAAGTTGGCGGACTTCGGATCGGCGGAGTGGTTTGGGATGAATGAGCGTGGTTCGATGACCGGAGTTGTTGGCACGCCGTACTATGTTGCACCAGAGGT...

Protein

Download Protein FASTA

146 aa · TkA07G348130|TK1151|PROTEIN

KKLIQNAVIQKNSECEAVSIFSQLIESISYCHRLGIAHRDIKRDNALFDSTGKLKLADFGSAEWFGMNERGSMTGVVGTPYYVAPEVLLGRSMTRRLTFGVPVSVSPEAKDLLRKMLCKDASRRLSVQQVSRHPWVISGGANRSNG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G348130`
TK1151 ID	TkA07G348130
OH-1004 ID	LXL04_035666
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	70.900
Protein coverage (%)	TK1151 91.781 / OH-1004 61.871 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G348130

Location Chr07:86996033-86996669 (-)

Description Similar to PPCK2: Phosphoenolpyruvate carboxylase kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04530`	Calcium-independent kinase involved in light-dependent phosphoenolpyruvate carboxylase phosphorylation.	No verified direct reference in this release
`At1g08650`	Calcium-independent kinase involved in light-dependent phosphoenolpyruvate carboxylase phosphorylation.	No verified direct reference in this release
`At3g49370`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0171500`	May play a role in signal transduction pathways that involve calcium as a second messenger (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035666 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046898 response to cycloheximide Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G08650

ath:AT1G61950

ath:AT1G76040

ath:AT2G41860

ath:AT3G04530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.543

Rank 1 · TkA07G348130 · TK1151

Nucleus0.500

Rank 2 · TkA07G348130 · TK1151

Cell membrane0.080

Rank 3 · TkA07G348130 · TK1151

Endoplasmic reticulum0.054

Rank 4 · TkA07G348130 · TK1151

Mitochondrion0.040

Rank 5 · TkA07G348130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13095FTA210-61 aa

PF00069Pkinase12-94 aa

PF07714PK_Tyr_Ser-Thr15-94 aa

PF03109ABC115-74 aa

PF14531Kinase-like20-65 aa

PF00069Pkinase98-136 aa

PF07714PK_Tyr_Ser-Thr101-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G348130	`PF13095`	FTA2	10	61	0.051	14.0
TkA07G348130	`PF00069`	Pkinase	12	94	3.7e-32	112.5
TkA07G348130	`PF07714`	PK_Tyr_Ser-Thr	15	94	7e-07	29.5
TkA07G348130	`PF03109`	ABC1	15	74	0.31	10.9
TkA07G348130	`PF14531`	Kinase-like	20	65	0.024	14.6
TkA07G348130	`PF00069`	Pkinase	98	136	3.7e-32	112.5
TkA07G348130	`PF07714`	PK_Tyr_Ser-Thr	101	131	7e-07	29.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VK0`	Arabidopsis thaliana	sp\|Q93VK0\|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2	39.000%	Swiss-Prot	Medium
`Q9SPK4`	Arabidopsis thaliana	sp\|Q9SPK4\|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1	38.600%	Swiss-Prot	Medium
`Q9SG12`	Arabidopsis thaliana	sp\|Q9SG12\|CAMK6_ARATH CDPK-related kinase 6	29.400%	Swiss-Prot	Low
`Q53P85`	Oryza sativa subsp. japonica	sp\|Q53P85\|CDPKO_ORYSJ Calcium-dependent protein kinase 24	31.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card