LXL04_035666 | RubberDandelionOmics

Gene overview

LXL04_035666

Reference: OH-1004 Chr: Chr08 Coordinates: 26700719-26701691 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

837 bp · LXL04_035666|LXL04_035666|OH1004|cDNA

ATGTCAGAGAGCTTGCAGAACGATTACGAGCTCTGTGAAGAGCTCGGCCGAGGTCAGTTCGGGATCATATACCGTTGTTTTTCACGGATTTCTGGTGAATCTTTTGCATGCAAATCGATTGACAAACGGCTCCTCTCCGACTCCACCGATCGGGAATGTATCGTGAAAGAACCGAAAATCCTCCGCGTTCTCGGCGGAAACGCTCATGTTACTCAGATTCACCGTATCTATGAAGATGAGAATTGGATCCATATGGTTAT...

CDS

Download CDS FASTA

837 bp · LXL04_035666|LXL04_035666|OH1004|CDS

ATGTCAGAGAGCTTGCAGAACGATTACGAGCTCTGTGAAGAGCTCGGCCGAGGTCAGTTCGGGATCATATACCGTTGTTTTTCACGGATTTCTGGTGAATCTTTTGCATGCAAATCGATTGACAAACGGCTCCTCTCCGACTCCACCGATCGGGAATGTATCGTGAAAGAACCGAAAATCCTCCGCGTTCTCGGCGGAAACGCTCATGTTACTCAGATTCACCGTATCTATGAAGATGAGAATTGGATCCATATGGTTAT...

Protein

Download Protein FASTA

278 aa · LXL04_035666|LXL04_035666|OH1004|PROTEIN

MSESLQNDYELCEELGRGQFGIIYRCFSRISGESFACKSIDKRLLSDSTDRECIVKEPKILRVLGGNAHVTQIHRIYEDENWIHMVIDLCEGPDLYERISKRGGAFSECEAVSIFSQLIESISYCHKLGIAHRDIKPDNVLFDSTGKLKLADFGSAEWFGMNERGSMTGVVGTPYYVAPEVLLGREYDEKVDVWSAGVILYILLGGVPPFYGETSVETFEAVVRGNLRFPTRIFRSVSPAAKDLLRKMLCKDASRRLSVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035666`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035666

Location Chr08:26700719-26701691 (-)

Description Similar to PPCK2: Phosphoenolpyruvate carboxylase kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04530`	Calcium-independent kinase involved in light-dependent phosphoenolpyruvate carboxylase phosphorylation.	No verified direct reference in this release
`At1g08650`	Calcium-independent kinase involved in light-dependent phosphoenolpyruvate carboxylase phosphorylation.	No verified direct reference in this release
`At2g41860`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At1g76040`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At1g61950`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035666 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046898 response to cycloheximide Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G08650

ath:AT1G61950

ath:AT1G76040

ath:AT2G41860

ath:AT3G04530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.608

Rank 1 · LXL04_035666 · OH-1004

Cytoplasm0.589

Rank 2 · LXL04_035666 · OH-1004

Cell membrane0.050

Rank 3 · LXL04_035666 · OH-1004

Mitochondrion0.037

Rank 4 · LXL04_035666 · OH-1004

Endoplasmic reticulum0.032

Rank 5 · LXL04_035666 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase9-268 aa

PF07714.24PK_Tyr_Ser-Thr11-263 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035666	`PF00069.32`	Pkinase	9	268	8e-70	235.9
LXL04_035666	`PF07714.24`	PK_Tyr_Ser-Thr	11	263	9.8e-29	101.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VK0`	Arabidopsis thaliana	Phosphoenolpyruvate carboxylase kinase 2	51.273%	Swiss-Prot	strong database homology
`Q9SPK4`	Arabidopsis thaliana	Phosphoenolpyruvate carboxylase kinase 1	50.373%	Swiss-Prot	strong database homology
`P93759`	Arabidopsis thaliana	Calcium-dependent protein kinase 14	44.928%	Swiss-Prot	moderate database homology
`Q8RWL2`	Arabidopsis thaliana	Calcium-dependent protein kinase 29	44.487%	Swiss-Prot	moderate database homology
`Q1PFH8`	Arabidopsis thaliana	Calcium-dependent protein kinase 19	44.161%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card