TkA07G342890 | RubberDandelionOmics

Gene overview

TkA07G342890

Reference: TK1151 Chr: Chr07 Coordinates: 85605900-85607327 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1074 bp · TkA07G342890|TK1151|cDNA

TCGTTTTCCAGAAGCTTCCTTACTTTTCTACAGCCTTCCACCGCCCTCTTCGTCATTACAAAAACCCTGTTATGCTCCATGACGCCTCCACACAAGCAAACTGAGTTGTTGAATCCGCAACCAAACTATCAAATCTTCACTGCCAGCTCCACCATTGTTCCGTTAACGAACGACCACACCAGAAATGGCTGCCTACCTAGCTCTCAAGAGAGGAACGACTGCAGCTACTCTCTTTAATAAACTCCTTACGCCGATTCGCT...

CDS

Download CDS FASTA

645 bp · TkA07G342890|TK1151|CDS

ATGGCTGCCTACCTAGCTCTCAAGAGAGGAACGACTGCAGCTACTCTCTTTAATAAACTCCTTACGCCGATTCGCTCTGCCTCTGCTACTCCCTGCGTACGACGGTGCTTCAACACTAATGCTTCTCAGGTGTCCGCTTATGATGATTTCAATCGATCCGTCGATGCGGATCGTCGTCCGGATTCCTCTGTTTCTCGCCGCCGTGACGGTGATTTCTTCTCAGATCTGTTCAATCCAATTTCTCCAACAAGGAGCTTGAG...

Protein

Download Protein FASTA

214 aa · TkA07G342890|TK1151|PROTEIN

MAAYLALKRGTTAATLFNKLLTPIRSASATPCVRRCFNTNASQVSAYDDFNRSVDADRRPDSSVSRRRDGDFFSDLFNPISPTRSLSQILNMMDQFTDNPFMSTALGGGFGARRGWDAKEDDNTLYLRFDMPGLDKENIKISVEQNTLIIKAEADKESEDDEEPPRRYSSRIDLPTDVYKLDEIKAEMKNGVLKVMVPKVKTEERKDVFQVQVE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G342890`
TK1151 ID	TkA07G342890
OH-1004 ID	LXL04_029744
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G342890

Location Chr07:85605900-85607327 (-)

Description Similar to HSP23.6: 23.6 kDa heat shock protein, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25200`	23.6 kDa heat shock protein, mitochondrial.	No verified direct reference in this release
`At5g51440`	23.5 kDa heat shock protein, mitochondrial.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0758000`	24.1 kDa heat shock protein, mitochondrial.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029744 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006950 response to stress Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT4G25200

ath:AT5G51440

gmx:547852

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.896

Rank 1 · TkA07G342890 · TK1151

Cytoplasm0.114

Rank 2 · TkA07G342890 · TK1151

Nucleus0.084

Rank 3 · TkA07G342890 · TK1151

Plastid0.079

Rank 4 · TkA07G342890 · TK1151

Cell membrane0.030

Rank 5 · TkA07G342890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19361DUF593773-106 aa

PF04969CS74-89 aa

PF00011HSP20117-213 aa

PF04969CS120-156 aa

PF27746Small_heat_shock_put121-199 aa

PF17886ArsA_HSP20123-196 aa

PF29697GerT_C123-196 aa

PF18046FKBP26_C127-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G342890	`PF19361`	DUF5937	73	106	0.28	11.0
TkA07G342890	`PF04969`	CS	74	89	0.023	16.4
TkA07G342890	`PF00011`	HSP20	117	213	9.5e-19	68.1
TkA07G342890	`PF04969`	CS	120	156	0.023	16.4
TkA07G342890	`PF27746`	Small_heat_shock_put	121	199	6.4e-11	42.7
TkA07G342890	`PF17886`	ArsA_HSP20	123	196	9.7e-08	32.2
TkA07G342890	`PF29697`	GerT_C	123	196	0.0049	17.5
TkA07G342890	`PF18046`	FKBP26_C	127	151	0.01	16.7
TkA07G342890	`PF10988`	DUF2807	137	159	0.42	11.1
TkA07G342890	`PF10988`	DUF2807	170	213	0.42	11.1
TkA07G342890	`PF04969`	CS	175	201	0.023	16.4
TkA07G342890	`PF18046`	FKBP26_C	177	200	0.01	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96331`	Arabidopsis thaliana	sp\|Q96331\|HS23M_ARATH 23.6 kDa heat shock protein, mitochondrial	52.900%	Swiss-Prot	High
`Q9FGM9`	Arabidopsis thaliana	sp\|Q9FGM9\|HS235_ARATH 23.5 kDa heat shock protein, mitochondrial	48.700%	Swiss-Prot	Medium
`Q6Z7V2`	Oryza sativa subsp. japonica	sp\|Q6Z7V2\|HS24M_ORYSJ 24.1 kDa heat shock protein, mitochondrial	48.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card