TkA07G320170 | RubberDandelionOmics

Gene overview

TkA07G320170

Reference: TK1151 Chr: Chr07 Coordinates: 80185654-80188614 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1941 bp · TkA07G320170|TK1151|cDNA

TTTATACTGAGCACACCCGTCAAAAATGCCAAAAAGAACGCTCCAGTCAAAATCCTAAGGTTTGGTGTCTCGACGGAGCACTCGATTAGTCAAATAAAGGTTAATATCAAGATTGCTTTGATTAGCTGATTGTTTTCGAAAATTTGGACCAGTTTGTTGCTGTGCGTTAAAGAGCGATGGATGTGGACAAATTCGAGCTCATAAAAGCTCAATTGCAACCGTTTTTACGGCAAGGGGAGGAGTATTTTCGGCGTGTCGAA...

CDS

Download CDS FASTA

420 bp · TkA07G320170|TK1151|CDS

ATGGATGTGGACAAATTCGAGCTCATAAAAGCTCAATTGCAACCGTTTTTACGGCAAGGGGAGGAGTATTTTCGGCGTGTCGAAGGGTTTGCTCGTGAGATCCCTCCAATTCAGATCTATATTGCTGTTGCAGCTGTGTTCTTGACTACATTGTTAATCTACATAATACGTGTGTTAAAGCATACAGTATCCAACACCATTGTACTGAGTGGCCTTAGTGGAGGTGGAAAAACCGTTCTTTTTTACCAGCTTCGTGATGG...

Protein

Download Protein FASTA

139 aa · TkA07G320170|TK1151|PROTEIN

MDVDKFELIKAQLQPFLRQGEEYFRRVEGFAREIPPIQIYIAVAAVFLTTLLIYIIRVLKHTVSNTIVLSGLSGGGKTVLFYQLRDGTSHQGTVTSMEPNEGHFVLNSETSKKGKIKAVRIVDVLGTHVFGLNLTNISL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G320170`
TK1151 ID	TkA07G320170
OH-1004 ID	LXL04_039117
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.600
Protein coverage (%)	TK1151 90.647 / OH-1004 47.015 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G320170`
Location	Chr07:80185654-80188614 (-)
Description	Similar to srprb: Signal recognition particle receptor subunit beta
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039117` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006617 SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition Biological Process GO:0007059 chromosome segregation Biological Process GO:0015031 protein transport Biological Process GO:0045047 protein targeting to ER Biological Process GO:0051301 cell division Biological Process GO:0051607 defense response to virus Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005765 lysosomal membrane Cellular Component GO:0005785 signal recognition particle receptor complex Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005819 spindle Cellular Component
KEGG gene cross-reference	ath:AT5G67560 ddi:DDB_G0278543 hsa:58477 mmu:20818 rno:300965 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.653

Rank 1 · TkA07G320170 · TK1151

Nucleus0.154

Rank 2 · TkA07G320170 · TK1151

Cytoplasm0.121

Rank 3 · TkA07G320170 · TK1151

Golgi apparatus0.087

Rank 4 · TkA07G320170 · TK1151

Mitochondrion0.073

Rank 5 · TkA07G320170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17988VEGFR-2_TMD41-60 aa

PF02367TsaE63-96 aa

PF09439SRPRB64-132 aa

PF20720nSTAND364-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G320170	`PF17988`	VEGFR-2_TMD	41	60	0.16	12.1
TkA07G320170	`PF02367`	TsaE	63	96	0.13	12.9
TkA07G320170	`PF09439`	SRPRB	64	132	1.2e-05	25.5
TkA07G320170	`PF20720`	nSTAND3	64	128	0.067	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card