LXL04_039117 | RubberDandelionOmics

Gene overview

LXL04_039117

Reference: OH-1004 Chr: Chr09 Coordinates: 59496331-59497660 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

807 bp · LXL04_039117|LXL04_039117|OH1004|cDNA

ATGGATGTGGACAAGTTAGAGCTTATAAAAGCTCAATTGCAACCGTTTTTACGGCAAGGGGAGGAGTATTTTCGACGTGTCGAAGGGTTTGCTCGTGAGATCCCTCCAATTCAGATCTATATTGCTGTTGCAGCTGTGCTCTTGACCACCTTGTTAATCTACATAATACGTGTGTTAAAGCACACAGTATCCAACACCATTGTACTGAGTGGCCTTAGTGGAGGTGGAAAAACCGTTCTTTTTTACCAGCTTCGTGATGG...

CDS

Download CDS FASTA

807 bp · LXL04_039117|LXL04_039117|OH1004|CDS

ATGGATGTGGACAAGTTAGAGCTTATAAAAGCTCAATTGCAACCGTTTTTACGGCAAGGGGAGGAGTATTTTCGACGTGTCGAAGGGTTTGCTCGTGAGATCCCTCCAATTCAGATCTATATTGCTGTTGCAGCTGTGCTCTTGACCACCTTGTTAATCTACATAATACGTGTGTTAAAGCACACAGTATCCAACACCATTGTACTGAGTGGCCTTAGTGGAGGTGGAAAAACCGTTCTTTTTTACCAGCTTCGTGATGG...

Protein

Download Protein FASTA

268 aa · LXL04_039117|LXL04_039117|OH1004|PROTEIN

MDVDKLELIKAQLQPFLRQGEEYFRRVEGFAREIPPIQIYIAVAAVLLTTLLIYIIRVLKHTVSNTIVLSGLSGGGKTVLFYQLRDGTSHQGTVTSMEPNEGHFVLNSETSKKGKIKAVRIVDVPGHSRLRPKLDEYIPVAAGIVFVVDAVEFLPNCRAVSEYLYDILTKASVVKRKIPLLILCNKVDKVTAHTKEFIRKQLEKEIDKLRTSRKAVSDADICNEFTLGVTGEAFSFSHCVNKVNVAEASALTGEIQPLEH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039117`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039117

Location Chr09:59496331-59497660 (-)

Description Similar to srprb: Signal recognition particle receptor subunit beta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67560`	May play a role in lysosome motility.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039117 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006617 SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0015031 protein transport Biological Process

GO:0045047 protein targeting to ER Biological Process

GO:0051301 cell division Biological Process

GO:0051607 defense response to virus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005765 lysosomal membrane Cellular Component

GO:0005785 signal recognition particle receptor complex Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005819 spindle Cellular Component

KEGG gene cross-reference

ath:AT5G67560

ddi:DDB_G0278543

hsa:58477

mmu:20818

rno:300965

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.667

Rank 1 · LXL04_039117 · OH-1004

Cytoplasm0.143

Rank 2 · LXL04_039117 · OH-1004

Nucleus0.120

Rank 3 · LXL04_039117 · OH-1004

Golgi apparatus0.106

Rank 4 · LXL04_039117 · OH-1004

Mitochondrion0.078

Rank 5 · LXL04_039117 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025.28Arf58-211 aa

PF09439.17SRPRB64-242 aa

PF00009.34GTP_EFTU103-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039117	`PF00025.28`	Arf	58	211	1.8e-15	57.5
LXL04_039117	`PF09439.17`	SRPRB	64	242	1.3e-34	119.8
LXL04_039117	`PF00009.34`	GTP_EFTU	103	254	7.1e-08	33.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y31`	Arabidopsis thaliana	ADP-ribosylation factor-like protein 8b	30.114%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card