TkA07G293220 | RubberDandelionOmics

Gene overview

TkA07G293220

Reference: TK1151 Chr: Chr07 Coordinates: 73523807-73524387 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

381 bp · TkA07G293220|TK1151|cDNA

TTTGCACAATATGATCAACCCAATGTCTCGTTTCGAAATACCCATGTGACCGTTAATGATGATGAAGACGAGGTTCAAACACATGGTACTGCAGCGGACCGTGAATTTATGACTCAGTTACGTGATGAAATTGCTGAGCAATTGATGCAAATCTTCTTCTTGCAGACTGCAGACGTTTGGTCCACCTCTTCTGCTGCAGAGGCTTGTAGATGTGGTCCGCAGACTGCAGATGTTTTGGCTTCGAAAAACAAACAGCACCT...

CDS

Download CDS FASTA

381 bp · TkA07G293220|TK1151|CDS

TTTGCACAATATGATCAACCCAATGTCTCGTTTCGAAATACCCATGTGACCGTTAATGATGATGAAGACGAGGTTCAAACACATGGTACTGCAGCGGACCGTGAATTTATGACTCAGTTACGTGATGAAATTGCTGAGCAATTGATGCAAATCTTCTTCTTGCAGACTGCAGACGTTTGGTCCACCTCTTCTGCTGCAGAGGCTTGTAGATGTGGTCCGCAGACTGCAGATGTTTTGGCTTCGAAAAACAAACAGCACCT...

Protein

Download Protein FASTA

126 aa · TkA07G293220|TK1151|PROTEIN

FAQYDQPNVSFRNTHVTVNDDEDEVQTHGTAADREFMTQLRDEIAEQLMQIFFLQTADVWSTSSAAEACRCGPQTADVLASKNKQHLYVVIVTIVTSNHKQANTYVFGTYMTCWGKIMKEFGGLML

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G293220`
TK1151 ID	TkA07G293220
OH-1004 ID	LXL04_021853
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.700
Protein coverage (%)	TK1151 66.667 / OH-1004 11.445 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G293220`
Location	Chr07:73523807-73524387 (-)
Description	Similar to dyrk2: Probable serine/threonine-protein kinase dyrk2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021853` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006468 protein phosphorylation Biological Process GO:0023052 signaling Biological Process GO:0032878 regulation of establishment or maintenance of cell polarity Biological Process GO:0045725 positive regulation of glycogen biosynthetic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005856 cytoskeleton Cellular Component GO:0005938 cell cortex Cellular Component GO:0032991 protein-containing complex Cellular Component GO:0051286 cell tip Cellular Component GO:0000287 magnesium ion binding Molecular Function
KEGG gene cross-reference	ddi:DDB_G0293750 dme:Dmel_CG40478 gga:427864 spo:2542228 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.406

Rank 1 · TkA07G293220 · TK1151

Cytoplasm0.388

Rank 2 · TkA07G293220 · TK1151

Mitochondrion0.196

Rank 3 · TkA07G293220 · TK1151

Cell membrane0.080

Rank 4 · TkA07G293220 · TK1151

Endoplasmic reticulum0.056

Rank 5 · TkA07G293220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20402DUF669216-70 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G293220	`PF20402`	DUF6692	16	70	0.11	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card