LXL04_021853 | RubberDandelionOmics

Gene overview

LXL04_021853

Reference: OH-1004 Chr: Chr04 Coordinates: 138686710-138691601 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2598 bp · LXL04_021853|LXL04_021853|OH1004|cDNA

ATGCTACACGATTTCCTTATTCGCTGCTTTTCTTCTAGAGCGGCTCTTCCACCGGCGAGCTCTGCCATCTGCGACAACCTTCCTTCGCCGATTTCCTTCTCCACCGGCGACCGACGACCTCTGCTACATCTGCGACAACCTCTTCTTCGGCGATTTCCCCTCTGTTCAACACGAACAAACTCCGATTTCTCCTGTTCCAAGCTTCGATTTCGCCTGTTCAGCACCCTACCTCCGATTTCGCTTCGGCTTTACTCTACAAA...

CDS

Download CDS FASTA

2598 bp · LXL04_021853|LXL04_021853|OH1004|CDS

ATGCTACACGATTTCCTTATTCGCTGCTTTTCTTCTAGAGCGGCTCTTCCACCGGCGAGCTCTGCCATCTGCGACAACCTTCCTTCGCCGATTTCCTTCTCCACCGGCGACCGACGACCTCTGCTACATCTGCGACAACCTCTTCTTCGGCGATTTCCCCTCTGTTCAACACGAACAAACTCCGATTTCTCCTGTTCCAAGCTTCGATTTCGCCTGTTCAGCACCCTACCTCCGATTTCGCTTCGGCTTTACTCTACAAA...

Protein

Download Protein FASTA

865 aa · LXL04_021853|LXL04_021853|OH1004|PROTEIN

MLHDFLIRCFSSRAALPPASSAICDNLPSPISFSTGDRRPLLHLRQPLLRRFPLCSTRTNSDFSCSKLRFRLFSTLPPISLRLYSTNTARFSILKRMAPFSLVTQRNIVVACFALHNFIRKEGLSDEYFAQYDQPNVSFRNTNVSVDDDEDEVQTHGTAADCEFMSQLRDEIAKQLMQSTDLFQQSADVKKQTVFFLQTADVWSTSSAAEVCRCGPQTTDVLVSKKQTTPKVLEFLRKNGLSDSESALMDDIIEKSQLGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021853`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_021853`
Location	Chr04:138686710-138691601 (+)
Description	Similar to dyrk2: Probable serine/threonine-protein kinase dyrk2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021853` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006468 protein phosphorylation Biological Process GO:0023052 signaling Biological Process GO:0032878 regulation of establishment or maintenance of cell polarity Biological Process GO:0045725 positive regulation of glycogen biosynthetic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005856 cytoskeleton Cellular Component GO:0005938 cell cortex Cellular Component GO:0032991 protein-containing complex Cellular Component GO:0051286 cell tip Cellular Component GO:0000287 magnesium ion binding Molecular Function
KEGG gene cross-reference	ddi:DDB_G0293750 dme:Dmel_CG40478 gga:427864 spo:2542228 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.470

Rank 1 · LXL04_021853 · OH-1004

Nucleus0.405

Rank 2 · LXL04_021853 · OH-1004

Mitochondrion0.110

Rank 3 · LXL04_021853 · OH-1004

Cell membrane0.076

Rank 4 · LXL04_021853 · OH-1004

Endoplasmic reticulum0.073

Rank 5 · LXL04_021853 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase561-861 aa

PF07714.24PK_Tyr_Ser-Thr562-761 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021853	`PF00069.32`	Pkinase	561	861	1.4e-51	176.1
LXL04_021853	`PF07714.24`	PK_Tyr_Ser-Thr	562	761	2.4e-18	67.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card