TkA07G285160 | RubberDandelionOmics

Gene overview

TkA07G285160

Reference: TK1151 Chr: Chr07 Coordinates: 71591355-71594010 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1365 bp · TkA07G285160|TK1151|cDNA

ATGTCAGATGTTGATGATGATAGAGGTGCCGGTGCTGCTACTCCTCCAGTCAGAATCAAGGAAATCGCAACCACATCGGTGGCTTGCCCGATGTTAACCCAGCCAAATTACACTGTATGGGCTCTTCGCATGAAGGCGATACCCGAAGCGCTAGTGATGCAAATCGGGGATGTCAGTTCCGCCAAGGCCCTCTGGGAAGCAATAAAAGCCCGTCACGTCGGCGCAGATCGCGTGAAAGAAGCCCGATTGCAAACCCTAAC...

CDS

Download CDS FASTA

1365 bp · TkA07G285160|TK1151|CDS

ATGTCAGATGTTGATGATGATAGAGGTGCCGGTGCTGCTACTCCTCCAGTCAGAATCAAGGAAATCGCAACCACATCGGTGGCTTGCCCGATGTTAACCCAGCCAAATTACACTGTATGGGCTCTTCGCATGAAGGCGATACCCGAAGCGCTAGTGATGCAAATCGGGGATGTCAGTTCCGCCAAGGCCCTCTGGGAAGCAATAAAAGCCCGTCACGTCGGCGCAGATCGCGTGAAAGAAGCCCGATTGCAAACCCTAAC...

Protein

Download Protein FASTA

454 aa · TkA07G285160|TK1151|PROTEIN

MSDVDDDRGAGAATPPVRIKEIATTSVACPMLTQPNYTVWALRMKAIPEALVMQIGDVSSAKALWEAIKARHVGADRVKEARLQTLTSEFDRLKMQESDTIDAFSGKLSGISSQSASLGESIEESKMVKKLLKSVPRKFIHIVAFLEQVLDLKTVGYEDVVGRLKAYEERVREADDGGESQARVMFVKNGGGAGSRNRGRNNRGEGFYHESRSAGGSGSNPAQNFKQPNFNDQPNSNKKCNCDCCEKNRRNRKNDRSKIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G285160`
TK1151 ID	TkA07G285160
OH-1004 ID	LXL04_034782
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	62.700
Protein coverage (%)	TK1151 62.335 / OH-1004 27.580 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G285160

Location Chr07:71591355-71594010 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65790`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At1g65800`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At1g11330`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330.	No verified direct reference in this release
`At4g03230`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230.	No verified direct reference in this release
`At4g00970`	Cysteine-rich receptor-like protein kinase 41.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034782 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.558

Rank 1 · TkA07G285160 · TK1151

Nucleus0.304

Rank 2 · TkA07G285160 · TK1151

Cell membrane0.246

Rank 3 · TkA07G285160 · TK1151

Endoplasmic reticulum0.063

Rank 4 · TkA07G285160 · TK1151

Mitochondrion0.031

Rank 5 · TkA07G285160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13961DUF421932-46 aa

PF14223Retrotran_gag_245-174 aa

PF13961DUF421962-68 aa

PF00098zf-CCHC260-276 aa

PF13696zf-CCHC_2260-276 aa

PF07714PK_Tyr_Ser-Thr295-405 aa

PF00069Pkinase300-344 aa

PF13961DUF4219353-358 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G285160	`PF13961`	DUF4219	32	46	0.05	14.1
TkA07G285160	`PF14223`	Retrotran_gag_2	45	174	3.6e-14	53.6
TkA07G285160	`PF13961`	DUF4219	62	68	0.05	14.1
TkA07G285160	`PF00098`	zf-CCHC	260	276	1.2e-06	29.1
TkA07G285160	`PF13696`	zf-CCHC_2	260	276	0.0023	18.4
TkA07G285160	`PF07714`	PK_Tyr_Ser-Thr	295	405	9.5e-08	32.4
TkA07G285160	`PF00069`	Pkinase	300	344	0.00067	19.9
TkA07G285160	`PF13961`	DUF4219	353	358	0.05	14.1
TkA07G285160	`PF11883`	DUF3403	410	454	1.6e-08	35.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39086`	Arabidopsis thaliana	sp\|Q39086\|SD17_ARATH Receptor-like serine/threonine-protein kinase SD1-7	47.500%	Swiss-Prot	Low
`Q9S972`	Arabidopsis thaliana	sp\|Q9S972\|SD16_ARATH Receptor-like serine/threonine-protein kinase SD1-6	46.800%	Swiss-Prot	Low
`Q9SXB8`	Arabidopsis thaliana	sp\|Q9SXB8\|Y1133_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330	46.100%	Swiss-Prot	Low
`Q9ZR08`	Arabidopsis thaliana	sp\|Q9ZR08\|Y4230_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230	45.500%	Swiss-Prot	Low
`O23081`	Arabidopsis thaliana	sp\|O23081\|CRK41_ARATH Cysteine-rich receptor-like protein kinase 41	41.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card