RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G283020
Reference: TK1151 Chr: Chr07 Coordinates: 70863046-70865762 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1510 bp · TkA07G283020|TK1151|cDNA

CTTTTGTTTACTATCCGCCGTATATTTCTTCTTCTCCGATGGATTCTCAGAACCCTGAACATGAACACAAACACACTGTTGACATATCAGCAGCCGTACCACCTGAAGAAAACCGCCAAACTACAAACAAAGTCTGTGGTGGAGCACCATGCGGATTCTCAGATTCCAACACAACTTCCATGGAAGCAAAAGAACGTTCAGCTTCCATGTGGAAGCTCTGGTGTGGTGTCATCTTATGCGTTATCTTCATGAGTGTAGAA...

CDS

Download CDS FASTA

1236 bp · TkA07G283020|TK1151|CDS

ATGTTTTCGCCAAAAGATTCAAACACGATGGATTCTCAGAACCCTGAACATGAACACAAACACACTGTTGACATATCAGCAGCCGTACCACCTGAAGAAAACCGCCAAACTACAAACAAAGTCTGTGGTGGAGCACCATGCGGATTCTCAGATTCCAACACAACTTCCATGGAAGCAAAAGAACGTTCAGCTTCCATGTGGAAGCTCTGGTGTGGTGTCATCTTATGCGTTATCTTCATGAGTGTAGAAGTAGTAGGTGG...

Protein

Download Protein FASTA

411 aa · TkA07G283020|TK1151|PROTEIN

MFSPKDSNTMDSQNPEHEHKHTVDISAAVPPEENRQTTNKVCGGAPCGFSDSNTTSMEAKERSASMWKLWCGVILCVIFMSVEVVGGIKANSLAILTDAAHLLSDVAAFAISIFSVWASGWEATPRQSYGFFRIEILGTLVSIQIIWLLTGILVYEAIERLLYGTVEVQGSLMFGISAFGLVVNIIMIFVLGHEHGHGHSHGHGHGHDHGVSVTTHDHGVSVTTHDHHHGHDDDHHHHGSGHGHGHDQNQPLLKTYSSQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G283020
TK1151 IDTkA07G283020
OH-1004 IDLXL04_029154
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)92.300
Protein coverage (%)TK1151 97.810 / OH-1004 97.704
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G283020
LocationChr07:70863046-70865762 (-)
DescriptionSimilar to MTP1: Metal tolerance protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g46800 Mediates zinc accumulation in roots and confers resistance to zinc.
Zinc transporter of Arabidopsis thaliana AtMTP1 is localized to vacuolar membranes and implicated in zinc homeostasis.2004 · DOI: 10.1093/pcp/pci015
A mutant strain Arabidopsis thaliana that lacks vacuolar membrane zinc transporter MTP1 revealed the latent tolerance to excessive zinc.2009 · DOI: 10.1093/pcp/pcp067
A mutation in the Arabidopsis thaliana cell wall biosynthesis gene pectin methylesterase 3 as well as its aberrant expression cause hypersensitivity specifically to Zn.2013 · DOI: 10.1111/tpj.12279
At3g58810 Involved in sequestration of excess zinc in the cytoplasm into vacuoles to maintain zinc homeostasis.
The Arabidopsis metal tolerance protein AtMTP3 maintains metal homeostasis by mediating Zn exclusion from the shoot under Fe deficiency and Zn oversupply.2006 · DOI: 10.1111/j.1365-313x.2006.02746.x
At3g61940 Involved in sequestration of excess zinc in the cytoplasm into vacuoles to maintain zinc homeostasis. No verified direct reference in this release
At2g29410 Involved in sequestration of excess zinc in the cytoplasm into vacuoles to maintain zinc homeostasis. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0128400 Involved in sequestration of excess zinc in the cytoplasm into vacuoles to maintain zinc homeostasis. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029154 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006829 zinc ion transport Biological Process
GO:0006882 intracellular zinc ion homeostasis Biological Process
GO:0010038 response to metal ion Biological Process
GO:0010043 response to zinc ion Biological Process
GO:0010312 detoxification of zinc ion Biological Process
GO:0030001 metal ion transport Biological Process
GO:0071577 zinc ion transmembrane transport Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005774 vacuolar membrane Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
KEGG gene cross-reference
ath:AT2G29410
ath:AT2G46800
ath:AT3G58810
ath:AT3G61940
dosa:Os05g0128400
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.346
Rank 1 · TkA07G283020 · TK1151
Cytoplasm0.293
Rank 2 · TkA07G283020 · TK1151
Cell membrane0.248
Rank 3 · TkA07G283020 · TK1151
Golgi apparatus0.228
Rank 4 · TkA07G283020 · TK1151
Endoplasmic reticulum0.146
Rank 5 · TkA07G283020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02535Zip13-37 aa
PF16479DUF505648-106 aa
PF01545Cation_efflux70-332 aa
PF16479DUF5056107-151 aa
PF16479DUF5056139-170 aa
PF02535Zip166-286 aa
PF16479DUF5056309-334 aa
PF16916ZT_dimer336-410 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G283020PF02535Zip13378.3e-0626.0
TkA07G283020PF16479DUF5056481062.29.6
TkA07G283020PF01545Cation_efflux703321.3e-43149.8
TkA07G283020PF16479DUF50561071512.29.6
TkA07G283020PF16479DUF50561391702.29.6
TkA07G283020PF02535Zip1662868.3e-0626.0
TkA07G283020PF16479DUF50563093342.29.6
TkA07G283020PF16916ZT_dimer3364102.2e-1247.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9ZT63Arabidopsis thalianasp|Q9ZT63|MTP1_ARATH Metal tolerance protein 170.800%Swiss-ProtHigh
Q9LXS1Arabidopsis thalianasp|Q9LXS1|MTPA2_ARATH Metal tolerance protein A264.900%Swiss-ProtHigh
Q9M271Arabidopsis thalianasp|Q9M271|MTPA1_ARATH Metal tolerance protein A164.100%Swiss-ProtHigh
Q6DBM8Arabidopsis thalianasp|Q6DBM8|MTPB_ARATH Metal tolerance protein B46.300%Swiss-ProtMedium
Q688R1Oryza sativa subsp. japonicasp|Q688R1|MTP1_ORYSJ Metal tolerance protein 172.900%Swiss-ProtHigh

JBrowse

View in Genome Browser