TkA07G277100 | RubberDandelionOmics

Gene overview

TkA07G277100

Reference: TK1151 Chr: Chr07 Coordinates: 69321410-69335673 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

763 bp · TkA07G277100|TK1151|cDNA

AAAAAAACACCCACTCACACAGTCACACTCACTCCCTAATGGACAAGATTTTACAAAATTTCATTCCAATCAATGGGCTAAACCTCCACGTAGCTGAGATTGGTTCCAAATCTTCACCGGCCGTGGTTTTCCTTCATGGGTTCCCCGGCACATGGTACACTTGGCGCCATCAGATGGTTGCTGTAGCAAATGCTGGTTACAGAGCCATTGCACCCGATTTCAGAGGATACGGGCTCTCTGATCCACCTCCACAGCCTGAA...

CDS

Download CDS FASTA

594 bp · TkA07G277100|TK1151|CDS

ATGGACAAGATTTTACAAAATTTCATTCCAATCAATGGGCTAAACCTCCACGTAGCTGAGATTGGTTCCAAATCTTCACCGGCCGTGGTTTTCCTTCATGGGTTCCCCGGCACATGGTACACTTGGCGCCATCAGATGGTTGCTGTAGCAAATGCTGGTTACAGAGCCATTGCACCCGATTTCAGAGGATACGGGCTCTCTGATCCACCTCCACAGCCTGAAAATGCATCCTTCGCTGACTTTGTCAACGATACGTCCTC...

Protein

Download Protein FASTA

197 aa · TkA07G277100|TK1151|PROTEIN

MDKILQNFIPINGLNLHVAEIGSKSSPAVVFLHGFPGTWYTWRHQMVAVANAGYRAIAPDFRGYGLSDPPPQPENASFADFVNDTSSILDSLSISKAFMTSKDFGAMVDYSFARVYPEKVAGIVTLVLPYMPPGAVKHHLPLSEGFYVRRWTRRSLRRSVRRTTALLLLSRDVRIELQVLLLVRERRRRDHTHCRSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G277100`
TK1151 ID	TkA07G277100
OH-1004 ID	LXL04_034611
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	70.900
Protein coverage (%)	TK1151 76.650 / OH-1004 47.319 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G277100`
Location	Chr07:69321410-69335673 (+)
Description	Similar to EPHX2: Bifunctional epoxide hydrolase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034611` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001558 regulation of cell growth Biological Process GO:0009636 response to toxic substance Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0016311 dephosphorylation Biological Process GO:0042632 cholesterol homeostasis Biological Process GO:0046272 stilbene catabolic process Biological Process GO:0046839 phospholipid dephosphorylation Biological Process GO:0090181 regulation of cholesterol metabolic process Biological Process GO:0097176 epoxide metabolic process Biological Process GO:0005777 peroxisome Cellular Component GO:0005782 peroxisomal matrix Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	hsa:2053 ssc:414425 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.310

Rank 1 · TkA07G277100 · TK1151

Peroxisome0.258

Rank 2 · TkA07G277100 · TK1151

Plastid0.195

Rank 3 · TkA07G277100 · TK1151

Mitochondrion0.158

Rank 4 · TkA07G277100 · TK1151

Nucleus0.144

Rank 5 · TkA07G277100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05448AXE123-65 aa

PF01738DLH25-90 aa

PF00561Abhydrolase_127-132 aa

PF12146Hydrolase_427-125 aa

PF07224Chlorophyllase27-71 aa

PF12697Abhydrolase_629-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G277100	`PF05448`	AXE1	23	65	0.34	10.3
TkA07G277100	`PF01738`	DLH	25	90	0.11	12.8
TkA07G277100	`PF00561`	Abhydrolase_1	27	132	3.5e-19	70.2
TkA07G277100	`PF12146`	Hydrolase_4	27	125	4.2e-09	36.8
TkA07G277100	`PF07224`	Chlorophyllase	27	71	0.35	10.3
TkA07G277100	`PF12697`	Abhydrolase_6	29	157	8.2e-11	43.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card