LXL04_034611 | RubberDandelionOmics

Gene overview

LXL04_034611

Reference: OH-1004 Chr: Chr07 Coordinates: 110497483-110499762 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1058 bp · LXL04_034611|LXL04_034611|OH1004|cDNA

ATGTTGACGCTCGACatccaaaaaatatatatatctcAGTTATTGGACTCCAGACGCAAAAAACGCTTGAAGTTGAAACACACGCACATCCTACTCCTAAGAAAATGGATAAAATCGAACACAAATTCCTACAAATCAATGGACTAAAGCTTCACGTAGCTGAGATCGGGTCTGAGTCATCGCCGGCGGTGATTTTCCTACACGGATTCCCGGAGATATGGTACACTTGGCGCCACCAAATGATTGCCGTCGCAAACGCT...

CDS

Download CDS FASTA

954 bp · LXL04_034611|LXL04_034611|OH1004|CDS

ATGGATAAAATCGAACACAAATTCCTACAAATCAATGGACTAAAGCTTCACGTAGCTGAGATCGGGTCTGAGTCATCGCCGGCGGTGATTTTCCTACACGGATTCCCGGAGATATGGTACACTTGGCGCCACCAAATGATTGCCGTCGCAAACGCTGGTTTCAGAGCAATTGCACCCGATTTCAGAGGATACGGGTTATCAGATCCGCCTGCAGAACCCGAGAAGGCTACCTTCACTGACTTTGTCAACGATATTGCATC...

Protein

Download Protein FASTA

317 aa · LXL04_034611|LXL04_034611|OH1004|PROTEIN

MDKIEHKFLQINGLKLHVAEIGSESSPAVIFLHGFPEIWYTWRHQMIAVANAGFRAIAPDFRGYGLSDPPAEPEKATFTDFVNDIASILDFLAISKVFVVAKDFGTMVAYPFVLHHPEKIAGIVTINMTFMPPAAFKSHPLPEGFYVTRWREPGRAEADFGRLDVKTVVRNIYILFSQSEIPIANENQEIMDLVKPLTPLPSWMTEEDLAIYGDLYEKSGFQTPLQVPYRSYMSLGPAEEVPKVEAPMLVILGEDDYALK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034611`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_034611`
Location	Chr07:110497483-110499762 (-)
Description	Similar to EPHX2: Bifunctional epoxide hydrolase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034611` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0001558 regulation of cell growth Biological Process GO:0009636 response to toxic substance Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0016311 dephosphorylation Biological Process GO:0042632 cholesterol homeostasis Biological Process GO:0046272 stilbene catabolic process Biological Process GO:0046839 phospholipid dephosphorylation Biological Process GO:0090181 regulation of cholesterol metabolic process Biological Process GO:0097176 epoxide metabolic process Biological Process GO:0005777 peroxisome Cellular Component GO:0005782 peroxisomal matrix Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	hsa:2053 ssc:414425 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.825

Rank 1 · LXL04_034611 · OH-1004

Nucleus0.370

Rank 2 · LXL04_034611 · OH-1004

Peroxisome0.070

Rank 3 · LXL04_034611 · OH-1004

Mitochondrion0.047

Rank 4 · LXL04_034611 · OH-1004

Endoplasmic reticulum0.045

Rank 5 · LXL04_034611 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146.16Hydrolase_426-130 aa

PF00561.27Abhydrolase_127-295 aa

PF12697.14Abhydrolase_629-302 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034611	`PF12146.16`	Hydrolase_4	26	130	2e-12	47.7
LXL04_034611	`PF00561.27`	Abhydrolase_1	27	295	1.1e-25	91.4
LXL04_034611	`PF12697.14`	Abhydrolase_6	29	302	1.5e-16	62.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card