TkA07G259650 | RubberDandelionOmics

Gene overview

TkA07G259650

Reference: TK1151 Chr: Chr07 Coordinates: 64943247-64944535 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

786 bp · TkA07G259650|TK1151|cDNA

GGAGTGGCTCGTGGACTAGCATATCTTCATGATCCAGCTGGGAAGCCAACAAAGAGTATTACACCGCGATATTAAAAGTTCCAACATATTACTAGATGAAAACTGGAATGCAAAGATCTCGGATTTGGGTTTATCCAAATTTGGTCCAGCCAATCAGCAATATACATTTCTTGTCTCCCGTGCTGTCGGTACATTTGGGTATTGTGATCCGTTATATGTAGAAACGGGGTTACTGACAAAGGAGTCGGATGTATACTCAT...

CDS

Download CDS FASTA

354 bp · TkA07G259650|TK1151|CDS

ATGATCCAGCTGGGAAGCCAACAAAGAGTATTACACCGCGATATTAAAAGTTCCAACATATTACTAGATGAAAACTGGAATGCAAAGATCTCGGATTTGGGTTTATCCAAATTTGGTCCAGCCAATCAGCAATATACATTTCTTGTCTCCCGTGCTGTCGGTACATTTGGGTATTGTGATCCGTTATATGTAGAAACGGGGTTACTGACAAAGGAGTCGGATGTATACTCATTTGGTGTGGTGATGTTTGAAGTTTTGTG...

Protein

Download Protein FASTA

117 aa · TkA07G259650|TK1151|PROTEIN

MIQLGSQQRVLHRDIKSSNILLDENWNAKISDLGLSKFGPANQQYTFLVSRAVGTFGYCDPLYVETGLLTKESDVYSFGVVMFEVLCGRLCIDNKSIHQSFTELMSQEGPWKTSIDE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G259650`
TK1151 ID	TkA07G259650
OH-1004 ID	LXL04_028996
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 86.325 / OH-1004 14.306 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G259650

Location Chr07:64943247-64944535 (-)

Description Similar to FH3: Formin-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55450`	Contributes to pathogen-associated molecular pattern (PAMP)-triggered immunity (PTI) signaling, including calcium signaling and root growth inhibition, and defense responses downstream of FLS2.	Receptor-like cytoplasmic kinases integrate signaling from multiple plant immune receptors and are targeted by a Pseudomonas syringae effector.2010 · DOI: 10.1016/j.chom.2010.03.007 BIK1 interacts with PEPRs to mediate ethylene-induced immunity.2013 · DOI: 10.1073/pnas.1215543110 Microbe-associated molecular pattern-induced calcium signaling requires the receptor-like cytoplasmic kinases, PBL1 and BIK1.2014 · DOI: 10.1186/s12870-014-0374-4 The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w
`At2g39360`	Probable receptor-like protein kinase At2g39360.	No verified direct reference in this release
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At4g34500`	Probable receptor-like serine/threonine-protein kinase At4g34500.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028996 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009556 microsporogenesis Biological Process

GO:0051017 actin filament bundle assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005819 spindle Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0009574 preprophase band Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

GO:0003779 actin binding Molecular Function

GO:0004721 phosphoprotein phosphatase activity Molecular Function

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G31810

ath:AT2G25050

ath:AT3G32400

dosa:Os07g0596300

dosa:Os10g0119300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.636

Rank 1 · TkA07G259650 · TK1151

Nucleus0.277

Rank 2 · TkA07G259650 · TK1151

Endoplasmic reticulum0.106

Rank 3 · TkA07G259650 · TK1151

Cell membrane0.091

Rank 4 · TkA07G259650 · TK1151

Mitochondrion0.068

Rank 5 · TkA07G259650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17667Pkinase_fungal4-25 aa

PF01636APH6-27 aa

PF00069Pkinase7-106 aa

PF07714PK_Tyr_Ser-Thr7-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G259650	`PF17667`	Pkinase_fungal	4	25	0.11	12.0
TkA07G259650	`PF01636`	APH	6	27	0.25	11.8
TkA07G259650	`PF00069`	Pkinase	7	106	2.4e-20	73.8
TkA07G259650	`PF07714`	PK_Tyr_Ser-Thr	7	96	1.6e-16	61.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H186`	Arabidopsis thaliana	sp\|Q8H186\|PBL1_ARATH Probable serine/threonine-protein kinase PBL1	55.800%	Swiss-Prot	High
`O80623`	Arabidopsis thaliana	sp\|O80623\|Y2393_ARATH Probable receptor-like protein kinase At2g39360	54.300%	Swiss-Prot	High
`Q9FN92`	Arabidopsis thaliana	sp\|Q9FN92\|Y5597_ARATH Probable receptor-like protein kinase At5g59700	56.500%	Swiss-Prot	High
`Q9FID9`	Arabidopsis thaliana	sp\|Q9FID9\|Y5389_ARATH Probable receptor-like protein kinase At5g38990	53.400%	Swiss-Prot	High
`Q6NKZ9`	Arabidopsis thaliana	sp\|Q6NKZ9\|Y4345_ARATH Probable receptor-like serine/threonine-protein kinase At4g34500	50.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card