TkA07G252650 | RubberDandelionOmics

Gene overview

TkA07G252650

Reference: TK1151 Chr: Chr07 Coordinates: 63041437-63045693 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

721 bp · TkA07G252650|TK1151|cDNA

TTGATGAGGGATCTTCCGTTCTCTGGACATGAGATGCTACAGGAACTTGAGAAAATAGTTCAAAAATTTGAGGAGAAGCTTTTTACTACTGCAACAAGCCAGTCTGCTTATTTGCGGTGTATATCGGTGAATATATTGAATGTGACAAGGAGATCACAAAATCCCGTGCCAGATGTAATGCAGTCAAACTCTGGTTCTGATAGTGTAACCCCCTCAGAAGAAGGTTCTTAGGTGATGCAGCTTTTGTCACGGATCTTGCA...

CDS

Download CDS FASTA

327 bp · TkA07G252650|TK1151|CDS

ATGCAGCTTTTGTCACGGATCTTGCACAACATCGGTTCAACTGGAATGCAGGAAAATGGCGACTCCTCTATGGTATCTAGTGATTGGAGGGATCAGCTTCAAGCAGATTCACGGCAATGGATTGTGAATAAGATAATGGATACCTTGAAGAGGCATCTTTCATTCTCTCACCGTGAGATGCAACAGGAAATTGAGAAAATGGCCGTGAGCTTTGAAGAGAAGATTTATACTGCTGCAACAAGCCAGTCTGATTATATGCG...

Protein

Download Protein FASTA

108 aa · TkA07G252650|TK1151|PROTEIN

MQLLSRILHNIGSTGMQENGDSSMVSSDWRDQLQADSRQWIVNKIMDTLKRHLSFSHREMQQEIEKMAVSFEEKIYTAATSQSDYMRKIFIKVPTMETSTSQSVADLA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G252650`
TK1151 ID	TkA07G252650
OH-1004 ID	LXL04_028941
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 29.189 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G252650

Location Chr07:63041437-63045693 (+)

Description Similar to MED15A: Mediator of RNA polymerase II transcription subunit 15a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15780`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028941 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0045723 positive regulation of fatty acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016592 mediator complex Cellular Component

GO:0003713 transcription coactivator activity Molecular Function

GO:0031490 chromatin DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G15780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.826

Rank 1 · TkA07G252650 · TK1151

Cytoplasm0.287

Rank 2 · TkA07G252650 · TK1151

Cell membrane0.036

Rank 3 · TkA07G252650 · TK1151

Endoplasmic reticulum0.022

Rank 4 · TkA07G252650 · TK1151

Mitochondrion0.020

Rank 5 · TkA07G252650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09606Med15_N5-23 aa

PF02172KIX26-94 aa

PF16987KIX_227-104 aa

PF09606Med15_N27-96 aa

PF09786CytochromB561_N27-69 aa

PF22944DGKD_4H32-68 aa

PF28865REX3_N37-86 aa

PF30408RcsD_peri37-89 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G252650	`PF09606`	Med15_N	5	23	0.00028	21.3
TkA07G252650	`PF02172`	KIX	26	94	0.0098	16.9
TkA07G252650	`PF16987`	KIX_2	27	104	9.8e-27	93.4
TkA07G252650	`PF09606`	Med15_N	27	96	0.00028	21.3
TkA07G252650	`PF09786`	CytochromB561_N	27	69	0.009	15.7
TkA07G252650	`PF22944`	DGKD_4H	32	68	0.047	14.7
TkA07G252650	`PF28865`	REX3_N	37	86	0.00059	20.8
TkA07G252650	`PF30408`	RcsD_peri	37	89	0.07	13.9
TkA07G252650	`PF24151`	ArlX	42	86	0.029	14.6
TkA07G252650	`PF19130`	DUF5813	51	106	0.015	15.9
TkA07G252650	`PF22944`	DGKD_4H	63	107	0.047	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I171`	Arabidopsis thaliana	sp\|F4I171\|MD15A_ARATH Mediator of RNA polymerase II transcription subunit 15a	51.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card