LXL04_028941 | RubberDandelionOmics

Gene overview

LXL04_028941

Reference: OH-1004 Chr: Chr06 Coordinates: 75285959-75291354 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1113 bp · LXL04_028941|LXL04_028941|OH1004|cDNA

ATGGATACCAGCCATTGGAGGCCTATGGAATGTGGTGATTGGAGGTCTCAGCTGCAAGAAGCTTCAAGGCAAAAGATTGTAAATGCCATAACGAATAGCTTGAAGAGGCATGTTACGTTTTCTGGACAAGAGGTGCAATATGCATTTAAGAAAACAGCTGTGGAAGTTGAAGAGTTGATTTATATTACTGCAATAAGTCAGTTGGAAGGAAAAAGAATGAAACATTATCTTGTTTCTTTCTCACATGTCATAAATCCTTT...

CDS

Download CDS FASTA

1113 bp · LXL04_028941|LXL04_028941|OH1004|CDS

ATGGATACCAGCCATTGGAGGCCTATGGAATGTGGTGATTGGAGGTCTCAGCTGCAAGAAGCTTCAAGGCAAAAGATTGTAAATGCCATAACGAATAGCTTGAAGAGGCATGTTACGTTTTCTGGACAAGAGGTGCAATATGCATTTAAGAAAACAGCTGTGGAAGTTGAAGAGTTGATTTATATTACTGCAATAAGTCAGTTGGAAGGAAAAAGAATGAAACATTATCTTGTTTCTTTCTCACATGTCATAAATCCTTT...

Protein

Download Protein FASTA

370 aa · LXL04_028941|LXL04_028941|OH1004|PROTEIN

MDTSHWRPMECGDWRSQLQEASRQKIVNAITNSLKRHVTFSGQEVQYAFKKTAVEVEELIYITAISQLEGKRMKHYLVSFSHVINPLIYLVDYFQKISLKMKKFETSSQNPIPTANSVNPSHSIHLPSNYPQPFPYINVMHNNIPSTAIQVGDSSIEDSSIESGHWRNHVQAHRQKILNWIMRFLMRDLPFSGHEMLQELEKIVQIFEEKLFTTATSQSAYLRCISVNILNVTRRSQNPVPDVMQSNSGSDSVTPSEEGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028941`
TK1151 ID	TkA07G252650
OH-1004 ID	LXL04_028941
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 29.189 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028941

Location Chr06:75285959-75291354 (+)

Description Similar to MED15A: Mediator of RNA polymerase II transcription subunit 15a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15780`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028941 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0045723 positive regulation of fatty acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016592 mediator complex Cellular Component

GO:0003713 transcription coactivator activity Molecular Function

GO:0031490 chromatin DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G15780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.644

Rank 1 · LXL04_028941 · OH-1004

Cytoplasm0.442

Rank 2 · LXL04_028941 · OH-1004

Cell membrane0.056

Rank 3 · LXL04_028941 · OH-1004

Endoplasmic reticulum0.034

Rank 4 · LXL04_028941 · OH-1004

Mitochondrion0.027

Rank 5 · LXL04_028941 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16987.11KIX_212-67 aa

PF16987.11KIX_2164-238 aa

PF09606.16Med15_N288-353 aa

PF16987.11KIX_2289-365 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028941	`PF16987.11`	KIX_2	12	67	5e-61	203.3
LXL04_028941	`PF16987.11`	KIX_2	164	238	5e-61	203.3
LXL04_028941	`PF09606.16`	Med15_N	288	353	3.3e-10	40.3
LXL04_028941	`PF16987.11`	KIX_2	289	365	5e-61	203.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I171`	Arabidopsis thaliana	Mediator of RNA polymerase II transcription subunit 15a	51.111%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card