TkA07G247480 | RubberDandelionOmics

Gene overview

TkA07G247480

Reference: TK1151 Chr: Chr07 Coordinates: 61753304-61754653 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

630 bp · TkA07G247480|TK1151|cDNA

ATGCAGAGCTTAGCGAAAAGGCAACGCGGGGTTCGTCAATGCTCTCGATTTTTCCTCGATGAATTCAAACGAAGAACGACAAGCCTTAGCAGTAGCAGCTGCAGCTCTCTCCTCGATCATTCGCTCACCTGTGATCCTGATTCTGTTGTATTAGTGGAAGGCAATGCGAGTTCGAGAACCGTAGTTCTCAACAGACCTTCCTTTCTCAATGCGCTTAACACTGCCATGGGACCTGGCGGACAACTAAAACTTGCAGATTT...

CDS

Download CDS FASTA

630 bp · TkA07G247480|TK1151|CDS

ATGCAGAGCTTAGCGAAAAGGCAACGCGGGGTTCGTCAATGCTCTCGATTTTTCCTCGATGAATTCAAACGAAGAACGACAAGCCTTAGCAGTAGCAGCTGCAGCTCTCTCCTCGATCATTCGCTCACCTGTGATCCTGATTCTGTTGTATTAGTGGAAGGCAATGCGAGTTCGAGAACCGTAGTTCTCAACAGACCTTCCTTTCTCAATGCGCTTAACACTGCCATGGGACCTGGCGGACAACTAAAACTTGCAGATTT...

Protein

Download Protein FASTA

209 aa · TkA07G247480|TK1151|PROTEIN

MQSLAKRQRGVRQCSRFFLDEFKRRTTSLSSSSCSSLLDHSLTCDPDSVVLVEGNASSRTVVLNRPSFLNALNTAMGPGGQLKLADFGLAHIFGCPDRSNNTDEITNDQVFARWYRAPELLFGAKQYGLGVDVWAAACIFAELLLRRPFLQGTVTSTNWVKSLLVHVESRKSHSVWLLHCMLIAAVCGSGPSCCCTQAAPRKIAAASSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G247480`
TK1151 ID	TkA07G247480
OH-1004 ID	LXL04_003849
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G247480

Location Chr07:61753304-61754653 (-)

Description Similar to CDKD-3: Cyclin-dependent kinase D-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18040`	May form a stable complex with cyclin CYCH1-1 that phosphorylates human CDK2 and the C-terminal domain (CTD) of the large subunit of RNA polymerase II.	No verified direct reference in this release
`At1g73690`	Cyclin-dependent kinase D-1.	No verified direct reference in this release
`At1g66750`	Forms a stable complex with cyclin CYCH1-1 that phosphorylates human CDK2 and the C-terminal domain (CTD) of the large subunit of RNA polymerase II.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Y4B6`	Cyclin-dependent kinase D-1.	No verified direct reference in this release
`Os05g0392300`	CDK-activating kinase that may control G1/S phase progression.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003849 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process

GO:0051301 cell division Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0070985 transcription factor TFIIK complex Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004693 cyclin-dependent protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G18040

ath:AT1G66750

ath:AT1G73690

dosa:Os05g0392300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.469

Rank 1 · TkA07G247480 · TK1151

Cytoplasm0.399

Rank 2 · TkA07G247480 · TK1151

Mitochondrion0.156

Rank 3 · TkA07G247480 · TK1151

Cell membrane0.057

Rank 4 · TkA07G247480 · TK1151

Endoplasmic reticulum0.049

Rank 5 · TkA07G247480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase20-47 aa

PF07714PK_Tyr_Ser-Thr76-145 aa

PF00069Pkinase80-157 aa

PF00069Pkinase171-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G247480	`PF00069`	Pkinase	20	47	5.9e-15	56.1
TkA07G247480	`PF07714`	PK_Tyr_Ser-Thr	76	145	0.0026	17.8
TkA07G247480	`PF00069`	Pkinase	80	157	5.9e-15	56.1
TkA07G247480	`PF00069`	Pkinase	171	192	5.9e-15	56.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMT0`	Arabidopsis thaliana	sp\|Q9LMT0\|CDKD3_ARATH Cyclin-dependent kinase D-3	75.000%	Swiss-Prot	Low
`Q9C9U2`	Arabidopsis thaliana	sp\|Q9C9U2\|CDKD1_ARATH Cyclin-dependent kinase D-1	75.000%	Swiss-Prot	Low
`Q9C9M7`	Arabidopsis thaliana	sp\|Q9C9M7\|CDKD2_ARATH Cyclin-dependent kinase D-2	67.900%	Swiss-Prot	Low
`A2Y4B6`	Oryza sativa subsp. indica	sp\|A2Y4B6\|CDKD1_ORYSI Cyclin-dependent kinase D-1	70.400%	Swiss-Prot	Low
`P29620`	Oryza sativa subsp. japonica	sp\|P29620\|CDKD1_ORYSJ Cyclin-dependent kinase D-1	70.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card