LXL04_003849 | RubberDandelionOmics

Gene overview

LXL04_003849

Reference: OH-1004 Chr: Chr01 Coordinates: 109279027-109280377 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

684 bp · LXL04_003849|LXL04_003849|OH1004|cDNA

ATGCAGAGCTTAGCGAAAAGGCAACGCGGGGTTCGTCAATGCTCTCGATTTTTCCTCGATGAATTCAAACGAAGAACGACAAGCCTTAGCAGTAGCAGCTGCAGCTCTCTCCTCGATCATTCGCTCACCTGTGATCCTGATTCTGTTGTATTAGTGGAAGGCAATGCGAGTTCGAGAACCGTAGTTCTCAACAGACCTTCCTTTCTCAATGCGCTCAACACTGCCATGGGACCTGGCGGACAACTAAAACTTGCAGATTT...

CDS

Download CDS FASTA

684 bp · LXL04_003849|LXL04_003849|OH1004|CDS

ATGCAGAGCTTAGCGAAAAGGCAACGCGGGGTTCGTCAATGCTCTCGATTTTTCCTCGATGAATTCAAACGAAGAACGACAAGCCTTAGCAGTAGCAGCTGCAGCTCTCTCCTCGATCATTCGCTCACCTGTGATCCTGATTCTGTTGTATTAGTGGAAGGCAATGCGAGTTCGAGAACCGTAGTTCTCAACAGACCTTCCTTTCTCAATGCGCTCAACACTGCCATGGGACCTGGCGGACAACTAAAACTTGCAGATTT...

Protein

Download Protein FASTA

227 aa · LXL04_003849|LXL04_003849|OH1004|PROTEIN

MQSLAKRQRGVRQCSRFFLDEFKRRTTSLSSSSCSSLLDHSLTCDPDSVVLVEGNASSRTVVLNRPSFLNALNTAMGPGGQLKLADFGLARIFGCPDRRFTHQVPFFPLNDHFIPGSNNTDEITNDQVFARWYRAPELLFGSKQYGSGVDVWAAACIFAELLLRRPFLQGTVTSTNWVKSLLVHVESRKSHSVWLLHCMLIAAVCGSGPSCCCTQAAPRKIVAASSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003849`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003849

Location Chr01:109279027-109280377 (+)

Description Similar to CDKD-3: Cyclin-dependent kinase D-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18040`	May form a stable complex with cyclin CYCH1-1 that phosphorylates human CDK2 and the C-terminal domain (CTD) of the large subunit of RNA polymerase II.	No verified direct reference in this release
`At1g73690`	Cyclin-dependent kinase D-1.	No verified direct reference in this release
`At1g66750`	Forms a stable complex with cyclin CYCH1-1 that phosphorylates human CDK2 and the C-terminal domain (CTD) of the large subunit of RNA polymerase II.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0392300`	CDK-activating kinase that may control G1/S phase progression.	No verified direct reference in this release
`UniProt: A2Y4B6`	Cyclin-dependent kinase D-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003849 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process

GO:0051301 cell division Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0070985 transcription factor TFIIK complex Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004693 cyclin-dependent protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G18040

ath:AT1G66750

ath:AT1G73690

dosa:Os05g0392300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.464

Rank 1 · LXL04_003849 · OH-1004

Cytoplasm0.380

Rank 2 · LXL04_003849 · OH-1004

Mitochondrion0.175

Rank 3 · LXL04_003849 · OH-1004

Cell membrane0.050

Rank 4 · LXL04_003849 · OH-1004

Endoplasmic reticulum0.041

Rank 5 · LXL04_003849 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase80-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003849	`PF00069.32`	Pkinase	80	174	8.2e-14	52.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMT0`	Arabidopsis thaliana	Cyclin-dependent kinase D-3	62.626%	Swiss-Prot	weak database homology
`Q9C9U2`	Arabidopsis thaliana	Cyclin-dependent kinase D-1	62.626%	Swiss-Prot	weak database homology
`Q9C9M7`	Arabidopsis thaliana	Cyclin-dependent kinase D-2	60.000%	Swiss-Prot	weak database homology
`P29620`	Oryza sativa subsp. japonica	Cyclin-dependent kinase D-1	62.626%	Swiss-Prot	weak database homology
`A2Y4B6`	Oryza sativa subsp. indica	Cyclin-dependent kinase D-1	62.626%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card