TkA07G240380 | RubberDandelionOmics

Gene overview

TkA07G240380

Reference: TK1151 Chr: Chr07 Coordinates: 60046946-60048577 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

998 bp · TkA07G240380|TK1151|cDNA

TTTTTTTTTAATTTGATATAAAAGAATATACCCTAATTGCACAAAGCCTTGTTCATCAACTAATTTTTAGCGGCGCTCGAGATTTTGCAGGTGCAAGTTAAAAACGAACGACGCAGCCAAAGAACTCACGAAGATGGAGGAAGGAGGGGTGGTAGTTCCAGAATCGGTAACCGAGGCAGTGAATAGAACCTCAAACAACTTTCAAGAATTCCGAACGAACTTCCTCGATTACTTGCCCCTTTGCGACCCTGATACTCTCT...

CDS

Download CDS FASTA

648 bp · TkA07G240380|TK1151|CDS

ATGGAGGAAGGAGGGGTGGTAGTTCCAGAATCGGTAACCGAGGCAGTGAATAGAACCTCAAACAACTTTCAAGAATTCCGAACGAACTTCCTCGATTACTTGCCCCTTTGCGACCCTGATACTCTCTTAGAATTGGACCCTCTTCAGCGTGCTCAATCTCTACTCTTGCTTGCAAAAGCCACCACCACACTCTTCACAATAAAGCTGCGTTGCAATGGCGTCGACCCAGATGACCATCCTGTCAGATCGGAACTTGAGAG...

Protein

Download Protein FASTA

215 aa · TkA07G240380|TK1151|PROTEIN

MEEGGVVVPESVTEAVNRTSNNFQEFRTNFLDYLPLCDPDTLLELDPLQRAQSLLLLAKATTTLFTIKLRCNGVDPDDHPVRSELERLNLYQEKLDRSINLSKAPLRPSATLNYQAATRFIEHSLPELTSDQRKNMREISRREGVKSGRSEGNVSKRRRKYLSSEKPSARTAAQEFLEKATRELLGNDKSSFKGPLKPRDEAEDEDEDEDDMAVG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G240380`
TK1151 ID	TkA07G240380
OH-1004 ID	LXL04_012270
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	41.500
Protein coverage (%)	TK1151 51.163 / OH-1004 44.622 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G240380`
Location	Chr07:60046946-60048577 (-)
Description	Similar to Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012270` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0008652 amino acid biosynthetic process Biological Process GO:0009073 aromatic amino acid family biosynthetic process Biological Process GO:0009423 chorismate biosynthetic process Biological Process GO:0009733 response to auxin Biological Process GO:0010078 maintenance of root meristem identity Biological Process GO:1902459 positive regulation of stem cell population maintenance Biological Process GO:0005634 nucleus Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009534 chloroplast thylakoid Cellular Component GO:0003700 DNA-binding transcription factor activity Molecular Function
KEGG gene cross-reference	ath:AT3G11260 ath:AT4G33510 nta:107775732 sly:544153 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.946

Rank 1 · TkA07G240380 · TK1151

Cytoplasm0.166

Rank 2 · TkA07G240380 · TK1151

Mitochondrion0.022

Rank 3 · TkA07G240380 · TK1151

Cell membrane0.015

Rank 4 · TkA07G240380 · TK1151

Golgi apparatus0.007

Rank 5 · TkA07G240380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03208PRA18-31 aa

PF04000Sas10_Utp316-94 aa

PF01424R3H121-158 aa

PF04000Sas10_Utp3122-134 aa

PF04000Sas10_Utp3169-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G240380	`PF03208`	PRA1	8	31	0.082	13.2
TkA07G240380	`PF04000`	Sas10_Utp3	16	94	1.3e-09	39.2
TkA07G240380	`PF01424`	R3H	121	158	0.14	12.9
TkA07G240380	`PF04000`	Sas10_Utp3	122	134	1.3e-09	39.2
TkA07G240380	`PF04000`	Sas10_Utp3	169	190	1.3e-09	39.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card