TkA07G149010 | RubberDandelionOmics

Gene overview

TkA07G149010

Reference: TK1151 Chr: Chr07 Coordinates: 38426383-38430213 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2242 bp · TkA07G149010|TK1151|cDNA

ATTTCTGTATCCGCAAGAATCATGGGCAAGCGCCGGCGTCGGACCTCTTCCTGCACCACGTCTTCTTCGTCTTCTTCATCTTCGTCGACCAACACTTCCTACACCTGTTCCACTGTACAAAATTCGGATCCTCAGCTCCTCTTCGGGATCATGCTTGCCGCTCTTTCGAACCGTGAATTGGGAGCCACATCAGAAGGAAACCTAGTTATCCAAAAAGCCCTACACCATCTTCTTCTCTCCCTCCTCTCCAAATCGCCCAA...

CDS

Download CDS FASTA

918 bp · TkA07G149010|TK1151|CDS

ATGGAGTTCCATTTTCAAGACTTTGCTTCTATTTCAGAAGGGCTGGCTTTTCTTTTCGGTCAACCGTCAACAGGGGTAAATTTGTACTTAACCCCACCAAATTCCCAAGGGCTATCTCGTCATTATGACGACCATTGTGTTCTCGTGTGCCAAATTCAAGGAGTTAAAAGATGGAAGGTGTTTCCCAATGTGGGTACACTGTTACCTCGCTTATATGAACCTTTTGTTGAGTTTATTGGTGTAGAGGGTAAAAGTGATAC...

Protein

Download Protein FASTA

306 aa · TkA07G149010|TK1151|PROTEIN

MEFHFQDFASISEGLAFLFGQPSTGVNLYLTPPNSQGLSRHYDDHCVLVCQIQGVKRWKVFPNVGTLLPRLYEPFVEFIGVEGKSDTDLMDDGCKEFLLREGDILYIPRGFPHEACTIADDDMANGNVDFSLHLTLAIEIEPPFEWEGFIHVAVNHWYHNCKITNHTNLDDVAVHLIHIAIKLIGENDPTFRKACLVGAISHQPWLQTHQHSIFNHLLSKVNINSNFKDIASNVLGEHKDILEKLRWIDNLDNKMPSMEM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G149010`
TK1151 ID	TkA07G149010
OH-1004 ID	LXL04_028384
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 40.157 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G149010`
Location	Chr07:38426383-38430213 (-)
Description	Similar to GL12933: Bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028384` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0042127 regulation of cell population proliferation Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0045471 response to ethanol Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005667 transcription regulator complex Cellular Component GO:0005730 nucleolus Cellular Component GO:0005829 cytosol Cellular Component GO:0003714 transcription corepressor activity Molecular Function GO:0005506 iron ion binding Molecular Function
KEGG gene cross-reference	aag:5571894 dpe:6597402 mmu:67014 rno:266670 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.380

Rank 1 · TkA07G149010 · TK1151

Nucleus0.259

Rank 2 · TkA07G149010 · TK1151

Endoplasmic reticulum0.163

Rank 3 · TkA07G149010 · TK1151

Golgi apparatus0.098

Rank 4 · TkA07G149010 · TK1151

Cell membrane0.094

Rank 5 · TkA07G149010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08007JmjC_24-119 aa

PF13621Cupin_818-160 aa

PF02311AraC_binding36-58 aa

PF13230GATase_460-130 aa

PF07883Cupin_279-115 aa

PF05899Cupin_389-115 aa

PF00190Cupin_192-113 aa

PF02311AraC_binding95-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G149010	`PF08007`	JmjC_2	4	119	2.5e-19	69.8
TkA07G149010	`PF13621`	Cupin_8	18	160	1.8e-08	35.3
TkA07G149010	`PF02311`	AraC_binding	36	58	0.17	12.3
TkA07G149010	`PF13230`	GATase_4	60	130	0.12	12.1
TkA07G149010	`PF07883`	Cupin_2	79	115	0.044	14.2
TkA07G149010	`PF05899`	Cupin_3	89	115	0.2	12.1
TkA07G149010	`PF00190`	Cupin_1	92	113	0.15	12.3
TkA07G149010	`PF02311`	AraC_binding	95	122	0.17	12.3
TkA07G149010	`PF11519`	DUF3222	169	209	0.14	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card