TkA07G133310 | RubberDandelionOmics

Gene overview

TkA07G133310

Reference: TK1151 Chr: Chr07 Coordinates: 34608929-34612485 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1894 bp · TkA07G133310|TK1151|cDNA

ATAATAATAAAAAAATAAAAAAAATAAAAAGCCTATTTCCAACGTTAATACTGTAATAACTTGCAGATGCCCTAAGAAACCCCCGAAAAGCCAACGGCTCCTATAAACTCTCAATTGGCTTCCTACCCGAGTGCAATTTGATCCTTTACTGGTTTCCCTTCATCATCAACACATCTGGTCTTCCGAAGTTGGATTCTATCTGTCGATCCCCCATTCTGTTGCGAGGATTTTGGAGCCAAAAAGAATGCATAACAAATTTG...

CDS

Download CDS FASTA

1632 bp · TkA07G133310|TK1151|CDS

ATGCATAACAAATTTGCAAGAAAAAACGCAATGGATGATAGACTAAGCAGCTTGGCGGATGATCTTATCCACAAAATCTTCTCTTTTATTAGCATGAAAGATGCTATCAAAAGCAGTGTTTTGTCATCTAGATGGAAGATTATGTGGACTTTAATGCCCTATTTGAATTTTGAGAATCAGTCCCACCTCTCCGAATTTATTTCTAATGTGTTTTCTCACCGCAATAATCAAATACAAGTTTCTTCACTCAATCTCCTTCT...

Protein

Download Protein FASTA

543 aa · TkA07G133310|TK1151|PROTEIN

MHNKFARKNAMDDRLSSLADDLIHKIFSFISMKDAIKSSVLSSRWKIMWTLMPYLNFENQSHLSEFISNVFSHRNNQIQVSSLNLLLGRTVMDDESVTTILNYTFSHNVEQLTVKRAQLDVKRALGDSIKFSYSFIKTPRCDQPCLTTLHLHHVKLSDDNGSLFSKCTNLKNLFLKRCGMKETKVLNICHSRLSNLTLEYTPPDLGLKEAVNVVAPQLKNLTTKMCEGKHMVNAPGLTSLVIQGFHPWQLSTPAGFHSLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G133310`
TK1151 ID	TkA07G133310
OH-1004 ID	LXL04_028247
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G133310

Location Chr07:34608929-34612485 (+)

Description Similar to At4g13965: Putative F-box/FBD/LRR-repeat protein At4g13965

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release
`At5g02930`	Putative F-box/LRR-repeat protein At5g02930.	No verified direct reference in this release
`At1g55660`	F-box/LRR-repeat protein At1g55660.	No verified direct reference in this release
`At4g00315`	Putative F-box/FBD/LRR-repeat protein At4g00315.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028247 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G04230

ath:AT3G51530

ath:AT5G02930

ath:AT5G56420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.711

Rank 1 · TkA07G133310 · TK1151

Cytoplasm0.271

Rank 2 · TkA07G133310 · TK1151

Cell membrane0.074

Rank 3 · TkA07G133310 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA07G133310 · TK1151

Mitochondrion0.033

Rank 5 · TkA07G133310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box15-51 aa

PF14666RICTOR_M41-86 aa

PF24758LRR_At5g56370142-225 aa

PF13862BCCIP143-199 aa

PF07723LRR_2145-160 aa

PF13855LRR_8146-176 aa

PF07723LRR_2169-179 aa

PF13855LRR_8182-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G133310	`PF00646`	F-box	15	51	7.8e-05	23.1
TkA07G133310	`PF14666`	RICTOR_M	41	86	0.08	13.4
TkA07G133310	`PF24758`	LRR_At5g56370	142	225	0.00057	20.3
TkA07G133310	`PF13862`	BCCIP	143	199	0.2	12.1
TkA07G133310	`PF07723`	LRR_2	145	160	0.28	12.6
TkA07G133310	`PF13855`	LRR_8	146	176	0.041	14.4
TkA07G133310	`PF07723`	LRR_2	169	179	0.28	12.6
TkA07G133310	`PF13855`	LRR_8	182	196	0.041	14.4
TkA07G133310	`PF14666`	RICTOR_M	252	276	0.08	13.4
TkA07G133310	`PF13862`	BCCIP	266	425	0.2	12.1
TkA07G133310	`PF00646`	F-box	378	384	7.8e-05	23.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM89`	Arabidopsis thaliana	sp\|Q9FM89\|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420	27.600%	Swiss-Prot	Low
`Q9LYZ2`	Arabidopsis thaliana	sp\|Q9LYZ2\|FBL80_ARATH Putative F-box/LRR-repeat protein At5g02930	25.800%	Swiss-Prot	Low
`Q1PFK0`	Arabidopsis thaliana	sp\|Q1PFK0\|FBL32_ARATH F-box/LRR-repeat protein At1g55660	30.600%	Swiss-Prot	Low
`Q3EAE5`	Arabidopsis thaliana	sp\|Q3EAE5\|FDL24_ARATH Putative F-box/FBD/LRR-repeat protein At4g00315	26.500%	Swiss-Prot	Low
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	26.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card