LXL04_028247 | RubberDandelionOmics

Gene overview

LXL04_028247

Reference: OH-1004 Chr: Chr06 Coordinates: 35724358-35727085 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1689 bp · LXL04_028247|LXL04_028247|OH1004|cDNA

ATGCATAACAAATTTGCAAGAAAAAACGCAATGGATGATAGACTAAGCAGCTTGCCGGATGATCTTATCCACAAAATCTTCTCTTTTATTAGCATGAAAGATGCTATCAAAAGCAGTGTTTTGTCATCTAGATGGAAGATTATGTGGACTTTAATGCCCTATTTGAATTTTGAGAATCAGTCCCACCTCTCCGAATTTATTTCTAATGTGTTTTCTCACCGCAATAATCAAATACAAGTTTCTTCACTCAATCTCCTTCT...

CDS

Download CDS FASTA

1689 bp · LXL04_028247|LXL04_028247|OH1004|CDS

ATGCATAACAAATTTGCAAGAAAAAACGCAATGGATGATAGACTAAGCAGCTTGCCGGATGATCTTATCCACAAAATCTTCTCTTTTATTAGCATGAAAGATGCTATCAAAAGCAGTGTTTTGTCATCTAGATGGAAGATTATGTGGACTTTAATGCCCTATTTGAATTTTGAGAATCAGTCCCACCTCTCCGAATTTATTTCTAATGTGTTTTCTCACCGCAATAATCAAATACAAGTTTCTTCACTCAATCTCCTTCT...

Protein

Download Protein FASTA

562 aa · LXL04_028247|LXL04_028247|OH1004|PROTEIN

MHNKFARKNAMDDRLSSLPDDLIHKIFSFISMKDAIKSSVLSSRWKIMWTLMPYLNFENQSHLSEFISNVFSHRNNQIQVSSLNLLLGRTVMDDESVTTILNYTFSHNVEQLTVKRAQLDVKRALGDSIKFSYSFIKTPRCDQPCLTTLHLHHVKLSDDNGSLFSKCTNLKNLFLKRCGMKETKVLNICHSRLSNLTLEYTPPDLGLKEAVNVVAPQLKNLTTKMCEGKHMVNAPGLTSLVIQGFHPWQLSTPAGFHSLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028247`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028247

Location Chr06:35724358-35727085 (+)

Description Similar to At4g13965: Putative F-box/FBD/LRR-repeat protein At4g13965

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13965`	Putative F-box/FBD/LRR-repeat protein At4g13965.	No verified direct reference in this release
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release
`At5g02930`	Putative F-box/LRR-repeat protein At5g02930.	No verified direct reference in this release
`At3g51530`	F-box/FBD/LRR-repeat protein At3g51530.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028247 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G04230

ath:AT3G51530

ath:AT5G02930

ath:AT5G56420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.712

Rank 1 · LXL04_028247 · OH-1004

Cytoplasm0.266

Rank 2 · LXL04_028247 · OH-1004

Cell membrane0.074

Rank 3 · LXL04_028247 · OH-1004

Endoplasmic reticulum0.046

Rank 4 · LXL04_028247 · OH-1004

Mitochondrion0.034

Rank 5 · LXL04_028247 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box15-51 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028247	`PF00646.39`	F-box	15	51	6.6e-07	29.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3EA38`	Arabidopsis thaliana	Putative F-box/FBD/LRR-repeat protein At4g13965	28.897%	Swiss-Prot	weak database homology
`Q9FM89`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At5g56420	25.680%	Swiss-Prot	weak database homology
`Q9LYZ2`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein At5g02930	26.115%	Swiss-Prot	weak database homology
`Q501E9`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At3g51530	28.846%	Swiss-Prot	weak database homology
`Q6NKX3`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At2g04230	26.048%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card