Gene Card
Gene overview
cDNA / CDS / Protein Sequences
312 bp · TkA07G130150|TK1151|cDNA
CAGTTCGCCATAGAGCAGTTTTTAAAAAGTTTACATCTAACACTTAACCACAAAAAAGCTTGGGTTAGGATTTCCGAAACTAACACAGGAATTGTTTTGACATTGTTGTTGAAGCAAATACTATTTCGATTCTGCCATATGGTCCACAGGAAAGCTCGAACTACCACCTCCTTCTTGATTGCGTCCATCTTCGAAGAATTCCGATCCGGGCTGCCCGTTAACAAGTCGTCTATTTCCCTGCACCCCATCAGATCTGGCAT...
312 bp · TkA07G130150|TK1151|CDS
CAGTTCGCCATAGAGCAGTTTTTAAAAAGTTTACATCTAACACTTAACCACAAAAAAGCTTGGGTTAGGATTTCCGAAACTAACACAGGAATTGTTTTGACATTGTTGTTGAAGCAAATACTATTTCGATTCTGCCATATGGTCCACAGGAAAGCTCGAACTACCACCTCCTTCTTGATTGCGTCCATCTTCGAAGAATTCCGATCCGGGCTGCCCGTTAACAAGTCGTCTATTTCCCTGCACCCCATCAGATCTGGCAT...
Protein
Download Protein FASTA103 aa · TkA07G130150|TK1151|PROTEIN
QFAIEQFLKSLHLTLNHKKAWVRISETNTGIVLTLLLKQILFRFCHMVHRKARTTTSFLIASIFEEFRSGLPVNKSSISLHPIRSGMALHLLGCSFETPPPLA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G130150 |
|---|---|
| TK1151 ID | TkA07G130150 |
| OH-1004 ID | LXL04_013739 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 43.600 |
| Protein coverage (%) | TK1151 75.728 / OH-1004 29.771Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G130150 |
|---|---|
| Location | Chr07:33665059-33665370 (-) |
| Description | Similar to AEL1: Protein AE7-like 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006259 DNA metabolic process Biological Process GO:0006974 DNA damage response Biological Process GO:0007059 chromosome segregation Biological Process GO:0009944 polarity specification of adaxial/abaxial axis Biological Process GO:0016226 iron-sulfur cluster assembly Biological Process GO:0042127 regulation of cell population proliferation Biological Process GO:0051604 protein maturation Biological Process GO:0051726 regulation of cell cycle Biological Process GO:1990067 intrachromosomal DNA recombination Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component |
| KEGG gene cross-reference | ath:AT1G68310 ath:AT3G09380 ath:AT3G50845 cel:CELE_F45G2.10 hsa:84191 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.