LXL04_013739 | RubberDandelionOmics

Gene overview

LXL04_013739

Reference: OH-1004 Chr: Chr03 Coordinates: 35118575-35120840 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

789 bp · LXL04_013739|LXL04_013739|OH1004|cDNA

ATGACTCTTGGATTGATAAACGCGAATCCGATTGTACGtgaaaagaaagagagaatCACTCGAACAGATGTTCATCATCACTGTGACGACCATGAAGCTGTTGATCCTCTTGAAATTTATGATATCCTTTCGAATTATCAATCGACAAATTTTGTGAGGGACATAAGAGATCCGGAGCATCCCTACTCGTTAGAACAGCTAAGCGTTTTATCGGAGGAGTCTATCACCGTCGATGAGAAGCTCGGTCGAATACTGATAAC...

CDS

Download CDS FASTA

789 bp · LXL04_013739|LXL04_013739|OH1004|CDS

ATGACTCTTGGATTGATAAACGCGAATCCGATTGTACGTGAAAAGAAAGAGAGAATCACTCGAACAGATGTTCATCATCACTGTGACGACCATGAAGCTGTTGATCCTCTTGAAATTTATGATATCCTTTCGAATTATCAATCGACAAATTTTGTGAGGGACATAAGAGATCCGGAGCATCCCTACTCGTTAGAACAGCTAAGCGTTTTATCGGAGGAGTCTATCACCGTCGATGAGAAGCTCGGTCGAATACTGATAAC...

Protein

Download Protein FASTA

262 aa · LXL04_013739|LXL04_013739|OH1004|PROTEIN

MTLGLINANPIVREKKERITRTDVHHHCDDHEAVDPLEIYDILSNYQSTNFVRDIRDPEHPYSLEQLSVLSEESITVDEKLGRILITFTPTIQHCSMATVIGLCLRVKLKDCFPPHFKVDIKVAPGSHADEAAVNKQLNDKERVVAAMENPNLRQLVDECLHSMLQISLTNMGMFCTLLLKQTSFLLHQMIHIKALTTTATLMASSLLFRGSTSSSSNSSMVVQPLRSGRVSHLLLSNPHTPFAVDQARNRCCTDSGQQA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013739`
TK1151 ID	TkA07G130150
OH-1004 ID	LXL04_013739
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	43.600
Protein coverage (%)	TK1151 75.728 / OH-1004 29.771 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013739

Location Chr03:35118575-35120840 (-)

Description Similar to AEL1: Protein AE7-like 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50845`	May play a role in chromosome segregation through establishment of sister chromatid cohesion (By similarity).	No verified direct reference in this release
`At1g68310`	Central member of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) pathway.	No verified direct reference in this release
`At3g09380`	May play a role in chromosome segregation through establishment of sister chromatid cohesion (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013739 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006259 DNA metabolic process Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0051604 protein maturation Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:1990067 intrachromosomal DNA recombination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G68310

ath:AT3G09380

ath:AT3G50845

cel:CELE_F45G2.10

hsa:84191

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.423

Rank 1 · LXL04_013739 · OH-1004

Nucleus0.338

Rank 2 · LXL04_013739 · OH-1004

Mitochondrion0.240

Rank 3 · LXL04_013739 · OH-1004

Cell membrane0.081

Rank 4 · LXL04_013739 · OH-1004

Endoplasmic reticulum0.062

Rank 5 · LXL04_013739 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A8MR89`	Arabidopsis thaliana	Protein AE7-like 1	70.552%	Swiss-Prot	moderate database homology
`Q9C9G6`	Arabidopsis thaliana	Protein AE7	56.707%	Swiss-Prot	moderate database homology
`Q9SR25`	Arabidopsis thaliana	Protein AE7-like 2	49.390%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card