RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G120080
Reference: TK1151 Chr: Chr07 Coordinates: 31149018-31154926 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3347 bp · TkA07G120080|TK1151|cDNA

CGGTTTATTCCCCCTATATTCCAGGTTCTCTTTGCCCTCCGCGTGTACCAGATTCTCTCTCCTCTCGAAATTTCCATTGTCGCAAAACATCATCACAAATCCAGCCATAAATCTCTCACTCCACACACACACAATTCTATCTCCACCAACGAAAAATCTGGGAGTGGCGGAGGTTTAATGGCGGGAAACGATTGGATTAACAGTTACTTGGACGCCATACTTGATGTAGGCCCTGGACTTGACGATGCAAAATCCTCCTT...

CDS

Download CDS FASTA

3273 bp · TkA07G120080|TK1151|CDS

CGGTTTATTCCCCCTATATTCCAGGTTCTCTTTGCCCTCCGCGTGTACCAGATTCTCTCTCCTCTCGAAATTTCCATTGTCGCAAAACATCATCACAAATCCAGCCATAAATCTCTCACTCCACACACACACAATTCTATCTCCACCAACGAAAAATCTGGGAGTGGCGGAGGTTTAATGGCGGGAAACGATTGGATTAACAGTTACTTGGACGCCATACTTGATGTAGGCCCTGGACTTGACGATGCAAAATCCTCCTT...

Protein

Download Protein FASTA

1090 aa · TkA07G120080|TK1151|PROTEIN

RFIPPIFQVLFALRVYQILSPLEISIVAKHHHKSSHKSLTPHTHNSISTNEKSGSGGGLMAGNDWINSYLDAILDVGPGLDDAKSSLLLRERGRFSPTRYFVDNVIGFDETDLHRSWVKAQATRSPQERNTRLENMCWRIWNLARQKKQLENEEAHRVAKRRIEREKGRNLAVADMSEDLSEGEKGETMNDVSTLGGDSHRGRLPRMSSVVAMETWANQQKGKKLYLILISLHGLIRGENMELGRDSDTGGQIKYVVELA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G120080
TK1151 IDTkA07G120080
OH-1004 IDLXL04_028085
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)96.900
Protein coverage (%)TK1151 94.587 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G120080
LocationChr07:31149018-31154926 (-)
DescriptionSimilar to SPS1: Probable sucrose-phosphate synthase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_028085 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0005986 sucrose biosynthetic process Biological Process
GO:0071836 nectar secretion Biological Process
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0046524 sucrose-phosphate synthase activity Molecular Function
KEGG gene cross-reference
ath:AT5G20280
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.350
Rank 1 · TkA07G120080 · TK1151
Endoplasmic reticulum0.236
Rank 2 · TkA07G120080 · TK1151
Nucleus0.122
Rank 3 · TkA07G120080 · TK1151
Cytoplasm0.110
Rank 4 · TkA07G120080 · TK1151
Cell membrane0.105
Rank 5 · TkA07G120080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08550GATA_AreA131-142 aa
PF00862GT-B_Sucrose_synth227-493 aa
PF13579Glyco_trans_4_4250-448 aa
PF13439Glyco_transf_4250-404 aa
PF00534Glycos_transf_1529-702 aa
PF13692Glyco_trans_1_4534-691 aa
PF20706GT4-conflict625-661 aa
PF13439Glyco_transf_4637-658 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G120080PF08550GATA_AreA1311420.01216.2
TkA07G120080PF00862GT-B_Sucrose_synth2274937.1e-0832.4
TkA07G120080PF13579Glyco_trans_4_42504480.0002922.0
TkA07G120080PF13439Glyco_transf_42504040.006517.2
TkA07G120080PF00534Glycos_transf_15297026.8e-2278.5
TkA07G120080PF13692Glyco_trans_1_45346911.4e-1455.3
TkA07G120080PF20706GT4-conflict6256610.007216.1
TkA07G120080PF13439Glyco_transf_46376580.006517.2
TkA07G120080PF05116S6PP82810456.3e-1452.9
TkA07G120080PF13439Glyco_transf_48949180.006517.2
TkA07G120080PF13439Glyco_transf_498810130.006517.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser