LXL04_028085 | RubberDandelionOmics

Gene overview

LXL04_028085

Reference: OH-1004 Chr: Chr06 Coordinates: 30904644-30909700 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3354 bp · LXL04_028085|LXL04_028085|OH1004|cDNA

CGGTTTATTCCCCCTATATTCCAGGTTCTCTTTGCCCTCCGCGTGTACCAGATTCTCTCTCCTCTCGAAATTTCCATTGTCGCAAAACATCATCACAAATCCAGCCATAAATCTCTCACTCCACACACACACAATTCTATCTCCACCAACGAAAAATCTGGGAGTGGCGGAGGTTTAATGGCGGGAAACGATTGGATTAACAGTTACTTGGACGCCATACTTGATGTAGGCCCTGGACTTGACGATGCAAAATCCTCCTT...

CDS

Download CDS FASTA

3177 bp · LXL04_028085|LXL04_028085|OH1004|CDS

ATGGCGGGAAACGATTGGATTAACAGTTACTTGGACGCCATACTTGATGTAGGCCCTGGACTTGACGATGCAAAATCCTCCTTGCTCCTCCGTGAAAGAGGCCGTTTTAGTCCTACACGCTACTTCGTCGACAACGTTATCGGCTTCGATGAGACTGATCTACATCGCTCTTGGGTTAAACCTGTCTATTGTCCCGTACTCCTGACTCCTGTAACTTCGTTTGAACGAGTTGAATTGAATCGCGATGTGTATTGTGCCCA...

Protein

Download Protein FASTA

1058 aa · LXL04_028085|LXL04_028085|OH1004|PROTEIN

MAGNDWINSYLDAILDVGPGLDDAKSSLLLRERGRFSPTRYFVDNVIGFDETDLHRSWVKPVYCPVLLTPVTSFERVELNRDVYCAQATRSPQERNTRLENMCWRIWNLARQKKQLENEEAHRVAKRRIEREKGRNLAVADMSEDLSEGEKGETMNDVSTLGGDSHRGRLPRMSSVVAMETWANQQKGKKLYLILISLHGLIRGENMELGRDSDTGGQIKYVVELARALASMPGVYRVDLLTRQVASPEVDWSYGEPTEM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028085`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028085

Location Chr06:30904644-30909700 (-)

Description Similar to SPS1: Probable sucrose-phosphate synthase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20280`	Plays a major role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP- glucose and fructose- 6-phosphate.	Decrease in leaf sucrose synthesis leads to increased leaf starch turnover and decreased RuBP regeneration-limited photosynthesis but not Rubisco-limited photosynthesis in Arabidopsis null mutants of SPSA1.2011 · DOI: 10.1111/j.1365-3040.2010.02265.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028085 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005986 sucrose biosynthetic process Biological Process

GO:0071836 nectar secretion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0046524 sucrose-phosphate synthase activity Molecular Function

KEGG gene cross-reference

ath:AT5G20280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.309

Rank 1 · LXL04_028085 · OH-1004

Nucleus0.292

Rank 2 · LXL04_028085 · OH-1004

Cell membrane0.138

Rank 3 · LXL04_028085 · OH-1004

Golgi apparatus0.101

Rank 4 · LXL04_028085 · OH-1004

Endoplasmic reticulum0.100

Rank 5 · LXL04_028085 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00862.27GT-B_Sucrose_synth193-459 aa

PF00534.27Glycos_transf_1495-668 aa

PF13692.13Glyco_trans_1_4500-657 aa

PF05116.20S6PP795-1013 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028085	`PF00862.27`	GT-B_Sucrose_synth	193	459	6.8e-08	32.4
LXL04_028085	`PF00534.27`	Glycos_transf_1	495	668	6.3e-22	78.6
LXL04_028085	`PF13692.13`	Glyco_trans_1_4	500	657	1.4e-14	55.3
LXL04_028085	`PF05116.20`	S6PP	795	1013	2.3e-13	51.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94BT0`	Arabidopsis thaliana	Sucrose-phosphate synthase 1	70.980%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card