TkA07G111620 | RubberDandelionOmics

Gene overview

TkA07G111620

Reference: TK1151 Chr: Chr07 Coordinates: 28908116-28908853 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

468 bp · TkA07G111620|TK1151|cDNA

ATGCCGATGAGAACAACCGGAGCTATGTCACAAGACTGGGAGCCGGTGGTGCTCCACAAATCCAGACCGAAGGCACAAGCCCTCCGTGATCCCAAGGCAGTGAACCAGGCCCTCCGCACCGGAGCTCAAGTCCAAACGGTGAAGAAATTCGACGGCGGAACTAACAAAAAGGCACCGGCCACAGCGGTTTATGCTAGAAAGCTTGATGAGGCAGCTGAGCCGGCAGCGCTTGATCGGGTGGCACCGGAGGTGAGGCAATT...

CDS

Download CDS FASTA

468 bp · TkA07G111620|TK1151|CDS

ATGCCGATGAGAACAACCGGAGCTATGTCACAAGACTGGGAGCCGGTGGTGCTCCACAAATCCAGACCGAAGGCACAAGCCCTCCGTGATCCCAAGGCAGTGAACCAGGCCCTCCGCACCGGAGCTCAAGTCCAAACGGTGAAGAAATTCGACGGCGGAACTAACAAAAAGGCACCGGCCACAGCGGTTTATGCTAGAAAGCTTGATGAGGCAGCTGAGCCGGCAGCGCTTGATCGGGTGGCACCGGAGGTGAGGCAATT...

Protein

Download Protein FASTA

155 aa · TkA07G111620|TK1151|PROTEIN

MPMRTTGAMSQDWEPVVLHKSRPKAQALRDPKAVNQALRTGAQVQTVKKFDGGTNKKAPATAVYARKLDEAAEPAALDRVAPEVRQLIQKARIDKKLSQADLAKQINERPQVVQEYENGKAVPNQAVLAKMERVLGVKLRGKVHNITLPSPSGVC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G111620`
TK1151 ID	TkA07G111620
OH-1004 ID	LXL04_001916
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	53.300
Protein coverage (%)	TK1151 87.742 / OH-1004 97.163 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G111620

Location Chr07:28908116-28908853 (-)

Description Similar to MBF1A: Multiprotein-bridging factor 1a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24500`	Transcriptional coactivator that stimulates transcriptional activity by bridging regulatory proteins and TBP, thereby recruiting TBP to promoters occupied by DNA-binding regulators.	Enhanced tolerance to environmental stress in transgenic plants expressing the transcriptional coactivator multiprotein bridging factor 1c.2005 · DOI: 10.1104/pp.105.070110 The transcriptional co-activator MBF1c is a key regulator of thermotolerance in Arabidopsis thaliana.2008 · DOI: 10.1074/jbc.m709187200
`At3g58680`	Transcriptional coactivator that stimulates transcriptional activity by bridging regulatory proteins and TBP, thereby recruiting TBP to promoters occupied by DNA-binding regulators.	No verified direct reference in this release
`At2g42680`	Transcriptional coactivator that stimulates transcriptional activity by bridging regulatory proteins and TBP, thereby recruiting TBP to promoters occupied by DNA-binding regulators.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001916 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0019216 regulation of lipid metabolic process Biological Process

GO:0043388 positive regulation of DNA binding Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G42680

ath:AT3G24500

ath:AT3G58680

hsa:8721

xla:444060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.833

Rank 1 · TkA07G111620 · TK1151

Cytoplasm0.285

Rank 2 · TkA07G111620 · TK1151

Mitochondrion0.029

Rank 3 · TkA07G111620 · TK1151

Endoplasmic reticulum0.024

Rank 4 · TkA07G111620 · TK1151

Cell membrane0.020

Rank 5 · TkA07G111620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08523MBF111-80 aa

PF13443HTH_2639-56 aa

PF13413HTH_2563-66 aa

PF24250HVO_271886-139 aa

PF12844HTH_1987-130 aa

PF01381HTH_388-140 aa

PF13443HTH_2688-138 aa

PF13413HTH_2588-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G111620	`PF08523`	MBF1	11	80	6.1e-21	75.4
TkA07G111620	`PF13443`	HTH_26	39	56	0.0014	19.6
TkA07G111620	`PF13413`	HTH_25	63	66	0.073	13.7
TkA07G111620	`PF24250`	HVO_2718	86	139	0.033	14.8
TkA07G111620	`PF12844`	HTH_19	87	130	0.0026	18.3
TkA07G111620	`PF01381`	HTH_3	88	140	1.7e-13	51.1
TkA07G111620	`PF13443`	HTH_26	88	138	0.0014	19.6
TkA07G111620	`PF13413`	HTH_25	88	120	0.073	13.7
TkA07G111620	`PF13560`	HTH_31	89	137	0.00039	21.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LV58`	Arabidopsis thaliana	sp\|Q9LV58\|MBF1C_ARATH Multiprotein-bridging factor 1c	74.000%	Swiss-Prot	High
`Q9LXT3`	Arabidopsis thaliana	sp\|Q9LXT3\|MBF1B_ARATH Multiprotein-bridging factor 1b	53.200%	Swiss-Prot	High
`Q9SJI8`	Arabidopsis thaliana	sp\|Q9SJI8\|MBF1A_ARATH Multiprotein-bridging factor 1a	52.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card