LXL04_001916 | RubberDandelionOmics

Gene overview

LXL04_001916

Reference: OH-1004 Chr: Chr01 Coordinates: 36844409-36845561 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

426 bp · LXL04_001916|LXL04_001916|OH1004|cDNA

ATGTCAGGTGGTCCGATTGCACAAGATTGGGAGCCCGTGGTCATCCGTAAGAAAGCTCCCACCGCCGCAGCGCGTAAGGACGAGAAAGCTGTCAACGCCGCCCGTCGCGCCGGTGCCGAGATCGAGACTGTACGCAAGGCTACTGCAGGTTCTAACAAAGCTGCCTCTAGTAGCACTTCTCTAAACACTAGAAAGCTTGATGAAGAGACTGAAAATCTCACCCATGAGAAGGTACCAAGTGAGTTAAAGAGAGCTATCAT...

CDS

Download CDS FASTA

426 bp · LXL04_001916|LXL04_001916|OH1004|CDS

ATGTCAGGTGGTCCGATTGCACAAGATTGGGAGCCCGTGGTCATCCGTAAGAAAGCTCCCACCGCCGCAGCGCGTAAGGACGAGAAAGCTGTCAACGCCGCCCGTCGCGCCGGTGCCGAGATCGAGACTGTACGCAAGGCTACTGCAGGTTCTAACAAAGCTGCCTCTAGTAGCACTTCTCTAAACACTAGAAAGCTTGATGAAGAGACTGAAAATCTCACCCATGAGAAGGTACCAAGTGAGTTAAAGAGAGCTATCAT...

Protein

Download Protein FASTA

141 aa · LXL04_001916|LXL04_001916|OH1004|PROTEIN

MSGGPIAQDWEPVVIRKKAPTAAARKDEKAVNAARRAGAEIETVRKATAGSNKAASSSTSLNTRKLDEETENLTHEKVPSELKRAIMQGRTDKKLTQAQLAQLINEKPQIIQEYESGKAIPNQQIITKLERALGVKLRGKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001916`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001916

Location Chr01:36844409-36845561 (-)

Description Similar to MBF1A: Multiprotein-bridging factor 1a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42680`	Transcriptional coactivator that stimulates transcriptional activity by bridging regulatory proteins and TBP, thereby recruiting TBP to promoters occupied by DNA-binding regulators.	No verified direct reference in this release
`At3g58680`	Transcriptional coactivator that stimulates transcriptional activity by bridging regulatory proteins and TBP, thereby recruiting TBP to promoters occupied by DNA-binding regulators.	No verified direct reference in this release
`At3g24500`	Transcriptional coactivator that stimulates transcriptional activity by bridging regulatory proteins and TBP, thereby recruiting TBP to promoters occupied by DNA-binding regulators.	Enhanced tolerance to environmental stress in transgenic plants expressing the transcriptional coactivator multiprotein bridging factor 1c.2005 · DOI: 10.1104/pp.105.070110 The transcriptional co-activator MBF1c is a key regulator of thermotolerance in Arabidopsis thaliana.2008 · DOI: 10.1074/jbc.m709187200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001916 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0019216 regulation of lipid metabolic process Biological Process

GO:0043388 positive regulation of DNA binding Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G42680

ath:AT3G24500

ath:AT3G58680

hsa:8721

xla:444060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.838

Rank 1 · LXL04_001916 · OH-1004

Cytoplasm0.292

Rank 2 · LXL04_001916 · OH-1004

Mitochondrion0.023

Rank 3 · LXL04_001916 · OH-1004

Endoplasmic reticulum0.022

Rank 4 · LXL04_001916 · OH-1004

Cell membrane0.018

Rank 5 · LXL04_001916 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08523.16MBF18-78 aa

PF01381.29HTH_386-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001916	`PF08523.16`	MBF1	8	78	4.7e-24	85.3
LXL04_001916	`PF01381.29`	HTH_3	86	138	2.4e-12	47.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJI8`	Arabidopsis thaliana	Multiprotein-bridging factor 1a	79.577%	Swiss-Prot	strong database homology
`Q9LXT3`	Arabidopsis thaliana	Multiprotein-bridging factor 1b	78.873%	Swiss-Prot	strong database homology
`Q9LV58`	Arabidopsis thaliana	Multiprotein-bridging factor 1c	49.640%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card