RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G095280
Reference: TK1151 Chr: Chr07 Coordinates: 24842609-24843169 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

459 bp · TkA07G095280|TK1151|cDNA

ATGCCCATGTTATACTATGGTCTTGTGGTTGTAGCCACAGCTGCCATCGTCCTTGCCATCTACAACCTCATAATTGTACGGTGGTGTGCCACCCAATACCGCCGCTCACGAGATGCTACTCAGCACTTCGGCCGCCGGAGAAACGCTGCTGCACGAAACAACAACATATCCCTGCCGTCGTCTTCTCTCTCCCGCGGTGGTTCAACCGTTGGTTTGACTTCGAGTTTTAGATACAAAAAAGAGATCGAGGACGGCGATGA...

CDS

Download CDS FASTA

459 bp · TkA07G095280|TK1151|CDS

ATGCCCATGTTATACTATGGTCTTGTGGTTGTAGCCACAGCTGCCATCGTCCTTGCCATCTACAACCTCATAATTGTACGGTGGTGTGCCACCCAATACCGCCGCTCACGAGATGCTACTCAGCACTTCGGCCGCCGGAGAAACGCTGCTGCACGAAACAACAACATATCCCTGCCGTCGTCTTCTCTCTCCCGCGGTGGTTCAACCGTTGGTTTGACTTCGAGTTTTAGATACAAAAAAGAGATCGAGGACGGCGATGA...

Protein

Download Protein FASTA

152 aa · TkA07G095280|TK1151|PROTEIN

MPMLYYGLVVVATAAIVLAIYNLIIVRWCATQYRRSRDATQHFGRRRNAAARNNNISLPSSSLSRGGSTVGLTSSFRYKKEIEDGDEVRKLPSCNHSFHASCIDMWLYSHSDCPLCRAPVEEPPPHHQHTDSALSEHSRDGLLDRASSSVSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G095280
TK1151 IDTkA07G095280
OH-1004 IDLXL04_027806
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)80.300
Protein coverage (%)TK1151 91.447 / OH-1004 18.723
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G095280
LocationChr07:24842609-24843169 (+)
DescriptionSimilar to Retrovirus-related Pol polyprotein from transposon TNT 1-94
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g10380 E3 ubiquitin-protein ligase that may be involved in positive regulation of programmed cell death (PCD) by facilitating degradation of negative regulators of PCD.
RING1 E3 ligase localizes to plasma membrane lipid rafts to trigger FB1-induced programmed cell death in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03625.x
At5g01880 RING-H2 finger protein ATL74. No verified direct reference in this release
At4g17905 Putative RING-H2 finger protein ATL53. No verified direct reference in this release
At1g72220 RING-H2 finger protein ATL54. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: Q9LRB7 Functions as an E3 ubiquitin-protein ligase in cooperation with the E2 ubiquitin conjugating enzymes UBC5A and UBC5B. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_027806 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006281 DNA repair Biological Process
GO:0006310 DNA recombination Biological Process
GO:0006508 proteolysis Biological Process
GO:0015074 DNA integration Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0071897 DNA biosynthetic process Biological Process
GO:0016020 membrane Cellular Component
GO:0042575 DNA polymerase complex Cellular Component
GO:0003676 nucleic acid binding Molecular Function
GO:0003964 RNA-directed DNA polymerase activity Molecular Function
GO:0004190 aspartic-type endopeptidase activity Molecular Function
GO:0004519 endonuclease activity Molecular Function
KEGG gene cross-reference
ath:AT5G01880
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.290
Rank 1 · TkA07G095280 · TK1151
Endoplasmic reticulum0.246
Rank 2 · TkA07G095280 · TK1151
Cell membrane0.241
Rank 3 · TkA07G095280 · TK1151
Cytoplasm0.223
Rank 4 · TkA07G095280 · TK1151
Nucleus0.173
Rank 5 · TkA07G095280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07219HemY_N9-53 aa
PF24623Phage_zn_bind_827-51 aa
PF23412zf_RING_Vps828-41 aa
PF08746zf-RING-like29-39 aa
PF23412zf_RING_Vps878-104 aa
PF13639zf-RING_281-117 aa
PF17123zf-RING_1181-103 aa
PF14634zf-RING_589-117 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G095280PF07219HemY_N9530.2212.4
TkA07G095280PF24623Phage_zn_bind_827511.89.1
TkA07G095280PF23412zf_RING_Vps828410.1612.5
TkA07G095280PF08746zf-RING-like29391.69.6
TkA07G095280PF23412zf_RING_Vps8781040.1612.5
TkA07G095280PF13639zf-RING_2811173.9e-1143.7
TkA07G095280PF17123zf-RING_11811032.7e-0627.7
TkA07G095280PF14634zf-RING_5891170.001119.6
TkA07G095280PF11793FANCL_C901120.02415.6
TkA07G095280PF12678zf-rbx1911174.2e-1040.4
TkA07G095280PF00097zf-C3HC4911161.5e-0525.5
TkA07G095280PF13445zf-RING_UBOX911120.01815.7
TkA07G095280PF12861zf-ANAPC11921186.7e-0523.6
TkA07G095280PF25143Zn_ribbon_IFT122_C921230.001219.4
TkA07G095280PF17120zf-RING_16921160.01216.0
TkA07G095280PF13923zf-C3HC4_2931163.9e-0730.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LX93Arabidopsis thalianasp|Q9LX93|ATL55_ARATH E3 ubiquitin-protein ligase RING154.500%Swiss-ProtLow
Q9LZV8Arabidopsis thalianasp|Q9LZV8|ATL74_ARATH RING-H2 finger protein ATL7470.300%Swiss-ProtLow
P0C041Arabidopsis thalianasp|P0C041|ATL53_ARATH Putative RING-H2 finger protein ATL5352.900%Swiss-ProtLow
Q8LFY8Arabidopsis thalianasp|Q8LFY8|ATL54_ARATH RING-H2 finger protein ATL5460.000%Swiss-ProtLow
Q9LRB7Oryza sativa subsp. japonicasp|Q9LRB7|EL5_ORYSJ E3 ubiquitin-protein ligase EL566.700%Swiss-ProtLow

JBrowse

View in Genome Browser