TkA07G081510 | RubberDandelionOmics

Gene overview

TkA07G081510

Reference: TK1151 Chr: Chr07 Coordinates: 21295591-21298409 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1256 bp · TkA07G081510|TK1151|cDNA

AAGCATCGTGCCATCGTCATTCGTCTCAGGAACATAAGATTTGGGATTGTTGAAGACAGTAAAGGTGGGACTAGTCAGCCATGGCCGGTGCCGATCCCGAAAAGCTGATCGCCAAAGCCGATAAACTGTCAGTTTACATTCTTCGCCATCGTTCTTAATCTGCTTGTTACCGATTTACAGTACCTAATTTCGCGATCGTGTTGCTGGTTGTTAAACTTTGAAATAATTCAAAACAAAACTTACTTTAACACGATGGAGTG...

CDS

Download CDS FASTA

699 bp · TkA07G081510|TK1151|CDS

ATGCTCGCTTCATATCCTGATGCTGGAAAGCATATGGAATCTGCTGGTGCTTTAGCTGTTGAATTAAGCATATGGAATGAAGTTGCTGATTTTTACAGAAGGGCTTCTGAGTTATATAATGAATGTGGGAGGTCACAGCCTGCATCTGATGCACTTGCAAAAGGTGCTCGTGCTTTAGAAGATGCTAAACCTGAGGTAGCCATTGCAATGTACACTGATGCTTGTTCACTACTTGAAGAAGATGGCAAGGAAAATATGGT...

Protein

Download Protein FASTA

232 aa · TkA07G081510|TK1151|PROTEIN

MLASYPDAGKHMESAGALAVELSIWNEVADFYRRASELYNECGRSQPASDALAKGARALEDAKPEVAIAMYTDACSLLEEDGKENMVFDIYRAITSVYIKLEKYTDAATFLLRWAVAANKCNALHSQCKAYLSAIIVYLYAHDFKEAEKCYNDCCQIDTFFSSDQSHCASKLLSAYREADIEEIQRVSKSSTVSNLDHMIIRLARKLPTGEVVAMEVNSVEHGEALDEDDLT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G081510`
TK1151 ID	TkA07G081510
OH-1004 ID	LXL04_027630
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.414 / OH-1004 83.088 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G081510

Location Chr07:21295591-21298409 (+)

Description Similar to GSNAP: Gamma-soluble NSF attachment protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20410`	Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027630 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0005829 cytosol Cellular Component

GO:0030659 cytoplasmic vesicle membrane Cellular Component

GO:0031201 SNARE complex Cellular Component

GO:0045335 phagocytic vesicle Cellular Component

GO:0005483 soluble NSF attachment protein activity Molecular Function

KEGG gene cross-reference

ath:AT4G20410

ddi:DDB_G0269186

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.704

Rank 1 · TkA07G081510 · TK1151

Nucleus0.373

Rank 2 · TkA07G081510 · TK1151

Lysosome / Vacuole0.105

Rank 3 · TkA07G081510 · TK1151

Golgi apparatus0.096

Rank 4 · TkA07G081510 · TK1151

Cell membrane0.096

Rank 5 · TkA07G081510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08311Mad3_BUB1_I23-55 aa

PF14938SNAP24-199 aa

PF07719TPR_225-40 aa

PF13176TPR_725-40 aa

PF00515TPR_129-39 aa

PF13424TPR_1230-80 aa

PF13428TPR_1432-59 aa

PF13181TPR_834-50 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G081510	`PF08311`	Mad3_BUB1_I	23	55	0.057	14.1
TkA07G081510	`PF14938`	SNAP	24	199	3.2e-12	47.2
TkA07G081510	`PF07719`	TPR_2	25	40	0.05	14.4
TkA07G081510	`PF13176`	TPR_7	25	40	0.2	12.6
TkA07G081510	`PF00515`	TPR_1	29	39	0.21	12.2
TkA07G081510	`PF13424`	TPR_12	30	80	0.0041	18.0
TkA07G081510	`PF13428`	TPR_14	32	59	0.0085	17.4
TkA07G081510	`PF13181`	TPR_8	34	50	0.21	12.6
TkA07G081510	`PF13428`	TPR_14	56	80	0.0085	17.4
TkA07G081510	`PF07719`	TPR_2	63	78	0.05	14.4
TkA07G081510	`PF13176`	TPR_7	63	77	0.2	12.6
TkA07G081510	`PF13181`	TPR_8	65	77	0.21	12.6
TkA07G081510	`PF08311`	Mad3_BUB1_I	80	125	0.057	14.1
TkA07G081510	`PF08919`	F_actin_bind	82	146	0.075	13.9
TkA07G081510	`PF13428`	TPR_14	89	123	0.0085	17.4
TkA07G081510	`PF13176`	TPR_7	93	115	0.2	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SPE5`	Arabidopsis thaliana	sp\|Q9SPE5\|SNAG_ARATH Gamma-soluble NSF attachment protein	71.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card