RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G078960
Reference: TK1151 Chr: Chr07 Coordinates: 20594861-20601698 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

5049 bp · TkA07G078960|TK1151|cDNA

TTTTCTATGATATAGTAGGAAACGGGTTTCCACTTCATCGTATGCTAAACCAGAAGAAAAACATCAACATATAATAAAAATTAAACCCCCAAAAAAACCTTGTTGGGTGTTCTCCAGCTATTCTTTCCAAATCCATCGACCACTTCTGTTCAATGGATCTGCCATTCCTGATTCAATCAATTTAAGATCTTAAATCAGGTGGTGGGTTCAATTCAATCAGTCAACTTGAACTATTGGAGGAGTTGAAAGATTCAAAGGGT...

CDS

Download CDS FASTA

4878 bp · TkA07G078960|TK1151|CDS

ATGAAGATACCTTGTTGCACGGTTTGTCAGACAAGGTACAACGAAGAAGATAGGTGTCCGTTGTTACTCGAGTGCGGCCATGGATTCTGTAAAGAGTGTCTCTCTCGTATGTTTTCATCAGCGTCATCAGACACTACTCTTTCCTGTCCACGATGTCGCCAAGTCTCCGTTGTCGGTAACTCCGTCCACGCGCTACGGAAGAACTACGCTATCTTGGGGCTAATCTCTTCTGCTTCCAATAGCGATTTCACCGACGAAGA...

Protein

Download Protein FASTA

1625 aa · TkA07G078960|TK1151|PROTEIN

MKIPCCTVCQTRYNEEDRCPLLLECGHGFCKECLSRMFSSASSDTTLSCPRCRQVSVVGNSVHALRKNYAILGLISSASNSDFTDEDEDDEDDGLVVVVDRDRRSCGSNASSSNGLIELGSHQDLRMVRRIGEEPGRKGSGVEMWSAVLSGKSGRCRHRVAVKKLVVIGEDTDLVWVQNQLDDLRLKSMWCRNVCKFHGATKVDDCLALIMDKCNGSVETEMQRNEGRLTLEQILRYGADIARGVAELHAAGVVCMNLKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G078960
TK1151 IDTkA07G078960
OH-1004 IDLXL04_027616
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.900
Protein coverage (%)TK1151 100.000 / OH-1004 98.545
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G078960
LocationChr07:20594861-20601698 (+)
DescriptionSimilar to KEG: E3 ubiquitin-protein ligase KEG
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g13530 Mediates E2-dependent protein ubiquitination.
Powdery mildew resistance conferred by loss of the ENHANCED DISEASE RESISTANCE1 protein kinase is suppressed by a missense mutation in KEEP ON GOING, a regulator of abscisic acid signaling.2008 · DOI: 10.1104/pp.108.127605
At3g23000 CIPK serine-threonine protein kinases interact with CBL proteins.
CIPK7 is involved in cold response by interacting with CBL1 in Arabidopsis thaliana.2011 · DOI: 10.1016/j.plantsci.2011.03.011
At5g18700 Essential protein that regulates phragmoplast microtubule organization during cell plate expansion in cytokinesis during cell division, both somatic and syncytial. No verified direct reference in this release
At4g08500 The MEKK1, MKK1/MKK2 and MPK4 function in a signaling pathway that modulates the expression of genes responding to biotic and abiotic stresses and also plays an important role in pathogen defense by negatively regulating innate immunity.
MAP kinase signalling cascade in Arabidopsis innate immunity.2002 · DOI: 10.1038/415977a
The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis.2004 · DOI: 10.1016/j.molcel.2004.06.023
Phosphorylation of Arabidopsis thaliana MEKK1 via Ca(2+) signaling as a part of the cold stress response.2013 · DOI: 10.1007/s10265-013-0576-0

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_027616 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0009704 de-etiolation Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process
GO:0010564 regulation of cell cycle process Biological Process
GO:0016197 endosomal transport Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0032940 secretion by cell Biological Process
GO:0045036 protein targeting to chloroplast Biological Process
GO:0045324 late endosome to vacuole transport Biological Process
GO:0048589 developmental growth Biological Process
KEGG gene cross-reference
ath:AT4G32250
ath:AT5G13530
mmu:244859
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.497
Rank 1 · TkA07G078960 · TK1151
Nucleus0.401
Rank 2 · TkA07G078960 · TK1151
Cell membrane0.199
Rank 3 · TkA07G078960 · TK1151
Endoplasmic reticulum0.056
Rank 4 · TkA07G078960 · TK1151
Golgi apparatus0.045
Rank 5 · TkA07G078960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639zf-RING_25-53 aa
PF13920zf-C3HC4_35-54 aa
PF12678zf-rbx15-53 aa
PF13445zf-RING_UBOX6-50 aa
PF00097zf-C3HC46-52 aa
PF14634zf-RING_56-54 aa
PF13923zf-C3HC4_26-52 aa
PF14570zf-RING_46-54 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G078960PF13639zf-RING_25531.7e-0628.9
TkA07G078960PF13920zf-C3HC4_35540.001618.9
TkA07G078960PF12678zf-rbx15530.03215.2
TkA07G078960PF13445zf-RING_UBOX6501.4e-0628.9
TkA07G078960PF00097zf-C3HC46529.3e-0626.1
TkA07G078960PF14634zf-RING_56541.3e-0525.7
TkA07G078960PF13923zf-C3HC4_26520.1312.8
TkA07G078960PF14570zf-RING_46540.1912.2
TkA07G078960PF24921RING_XB3-XBAT316541.110.0
TkA07G078960PF23412zf_RING_Vps86521.89.2
TkA07G078960PF17123zf-RING_116342.08.9
TkA07G078960PF14447Prok-RING_46542.19.0
TkA07G078960PF15227zf-C3HC4_420520.00517.6
TkA07G078960PF25080zf_RING-like24524.38.1
TkA07G078960PF09788Tmemb_55A29780.007816.1
TkA07G078960PF07714PK_Tyr_Ser-Thr1434141e-2384.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FY48Arabidopsis thalianasp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG71.500%Swiss-ProtHigh
Q9XIW0Arabidopsis thalianasp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 727.400%Swiss-ProtLow
F4JY37Arabidopsis thalianasp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL26.300%Swiss-ProtLow
Q39008Arabidopsis thalianasp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 124.800%Swiss-ProtLow

JBrowse

View in Genome Browser