TkA07G077750 | RubberDandelionOmics

Gene overview

TkA07G077750

Reference: TK1151 Chr: Chr07 Coordinates: 20245679-20253213 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2297 bp · TkA07G077750|TK1151|cDNA

CACAAATAAGTCAAATATATACATAAGCTACAACTAATTAGGATTAAAATTACCTAGGGACTAATAGAAAGTGTTTTTTGAGATACAAATATAGCGAGTTTTTTGTTTCTTTGAATCTTTGAAACCTTTTCGACAAGATTCATTCCACAAGGAAAAGATTCTCACTCCATGAATGCTCGTCTCGTCATCTCAGCTTCGCTCGTTCTTCTTTTCTCCCTTTTACTCTCACTTCATCTCCACAATAATCACAATGACTCGAG...

CDS

Download CDS FASTA

1134 bp · TkA07G077750|TK1151|CDS

ATGAATGCTCGTCTCGTCATCTCAGCTTCGCTCGTTCTTCTTTTCTCCCTTTTACTCTCACTTCATCTCCACAATAATCACAATGACTCGAGCTGGAGTAACCGATTACGGTGGTTATCATCGAAATCACCCTTCTCTTCAGGAATCACTGCTGATTTGTTGGTGACGAATGGAACGATATACACCAGCGATTCCTCTCTTCCATTTGCTGATTCCATGGCTATCCGTGACGGGAGAATTCTCCGAATTGGCAACTATTC...

Protein

Download Protein FASTA

377 aa · TkA07G077750|TK1151|PROTEIN

MNARLVISASLVLLFSLLLSLHLHNNHNDSSWSNRLRWLSSKSPFSSGITADLLVTNGTIYTSDSSLPFADSMAIRDGRILRIGNYSFVQEMSGYGTRELNLEGKVVVPGFIDSHVHLLFGGLQMARVEVRGVKTKKDFIEKVKDAVKNMKEGSWLLGGGWNNDLWGGELPSASWIDEITPHHPVWLSRMDGHMGLANSLALKIAGVTSNMQDPVGGTITRNANGEATGLMIDSAMKVILSCIPEVSVEERRQALDRASR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G077750`
TK1151 ID	TkA07G077750
OH-1004 ID	LXL04_027605
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.900
Protein coverage (%)	TK1151 94.164 / OH-1004 60.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G077750

Location Chr07:20245679-20253213 (+)

Description Similar to LAF3: Protein LONG AFTER FAR-RED 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55850`	Required for phyA-controlled responses to continuous far-red light (FRc) conditions, including the inhibition of hypocotyl elongation and the regulation of XTH15/XTR7 expression.	LAF3, a novel factor required for normal phytochrome A signaling.2003 · DOI: 10.1104/pp.103.028480

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027605 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009704 de-etiolation Biological Process

GO:0009845 seed germination Biological Process

GO:0010218 response to far red light Biological Process

GO:0019556 L-histidine catabolic process to glutamate and formamide Biological Process

GO:0019557 L-histidine catabolic process to glutamate and formate Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0048471 perinuclear region of cytoplasm Cellular Component

GO:0005506 iron ion binding Molecular Function

KEGG gene cross-reference

ag:BAD37143

ath:AT3G55850

bsu:BSU29550

pha:PSHAa2737

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.406

Rank 1 · TkA07G077750 · TK1151

Lysosome / Vacuole0.197

Rank 2 · TkA07G077750 · TK1151

Golgi apparatus0.180

Rank 3 · TkA07G077750 · TK1151

Cytoplasm0.082

Rank 4 · TkA07G077750 · TK1151

Cell membrane0.054

Rank 5 · TkA07G077750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07969Amidohydro_399-356 aa

PF01979Amidohydro_1106-121 aa

PF01979Amidohydro_1246-275 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G077750	`PF07969`	Amidohydro_3	99	356	1.9e-42	147.1
TkA07G077750	`PF01979`	Amidohydro_1	106	121	0.0021	18.1
TkA07G077750	`PF01979`	Amidohydro_1	246	275	0.0021	18.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A1I9LN01`	Arabidopsis thaliana	sp\|A0A1I9LN01\|LAF3_ARATH Protein LONG AFTER FAR-RED 3	66.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card