TkA07G068560 | RubberDandelionOmics

Gene overview

TkA07G068560

Reference: TK1151 Chr: Chr07 Coordinates: 17997161-18001507 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2238 bp · TkA07G068560|TK1151|cDNA

CATAAATAAGCAAAGAACTATTGATTAAGCTTTTCAACAATAATAAAAAAAGATTAAAACCCACAAGTGCTTACAATAATTGCTTTAAAAATCTTTAAACTTTTTTTTTTATATTTAACTGCTTCAATTATCTTCTCTCCCTTTCTCTCTGATGCAATTTACAGGCTTTGCTTTTCTGTATGAAACTGCAAAAAGATAAGTTTCAAGCGGAGCTTCCCTTCTGACATTTCCGGCCTGCAAACACCTTATGAACTTGATAC...

CDS

Download CDS FASTA

1392 bp · TkA07G068560|TK1151|CDS

ATGGAGGTGGATGAAATTGAAAGACAGGTGAGTAAGTTTCAAAGGGTTGGTTCTAATGGTGATAATTCTTCAAACCCTCATAAGATAGCTACCCTGAGAGGGAATTTGGATGTACGAAACCTGGAGCATCGGTTTCCCGATGAGAATGGCGGCGGCGGCGGGGGTGGAGTTGTTGGGAGGCTTTGTGGATGGCCGTCGTCGCGGATCGTTAGGGTTTCTAGGGCTTCGGGTGGGAAGGATAGACACAGTAAGGTTTTGAC...

Protein

Download Protein FASTA

463 aa · TkA07G068560|TK1151|PROTEIN

MEVDEIERQVSKFQRVGSNGDNSSNPHKIATLRGNLDVRNLEHRFPDENGGGGGGGVVGRLCGWPSSRIVRVSRASGGKDRHSKVLTSKGLRDRRVRLSVTTAIQFYDLQDRLGYDQPSKAVEWLIKAASSSISELPSLDPSFPGADGYNQHHHHNNQHQKQLSDEKKSTGNDNEFEDPNYQDNQQQNNTNNTNNNNVSVSKSSACSSTSETSKGSGLSLSRSENRVRARERARDMAAKKEKEKDGDPVRAAVVTQVNGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G068560`
TK1151 ID	TkA07G068560
OH-1004 ID	LXL04_027506
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 97.624 / OH-1004 65.418 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G068560

Location Chr07:17997161-18001507 (-)

Description Similar to TCP2: Transcription factor TCP2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18390`	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164).	TCP2 positively regulates HY5/HYH and photomorphogenesis in Arabidopsis.2016 · DOI: 10.1093/jxb/erv495
`At1g30210`	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164).	ABAP1 is a novel plant Armadillo BTB protein involved in DNA replication and transcription.2008 · DOI: 10.1038/emboj.2008.191

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0785800`	Transcription activator.	No verified direct reference in this release
`UniProt: A2XMN1`	Transcription activator.	No verified direct reference in this release
`UniProt: A2ZMR9`	Transcription activator.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027506 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009637 response to blue light Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048366 leaf development Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:2000306 positive regulation of photomorphogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G30210

ath:AT4G18390

dosa:Os03g0785800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · TkA07G068560 · TK1151

Cytoplasm0.087

Rank 2 · TkA07G068560 · TK1151

Cell membrane0.025

Rank 3 · TkA07G068560 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA07G068560 · TK1151

Plastid0.010

Rank 5 · TkA07G068560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03634TCP77-243 aa

PF22251PFF1_TM150-241 aa

PF10500SR-25157-243 aa

PF01080Presenilin157-232 aa

PF10486PI3K_1B_p101163-228 aa

PF05053Menin168-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G068560	`PF03634`	TCP	77	243	9.6e-41	140.6
TkA07G068560	`PF22251`	PFF1_TM	150	241	6.6	6.9
TkA07G068560	`PF10500`	SR-25	157	243	0.023	15.0
TkA07G068560	`PF01080`	Presenilin	157	232	8.2	5.8
TkA07G068560	`PF10486`	PI3K_1B_p101	163	228	6.5	5.1
TkA07G068560	`PF05053`	Menin	168	243	5.2	6.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93V43`	Arabidopsis thaliana	sp\|Q93V43\|TCP2_ARATH Transcription factor TCP2	71.600%	Swiss-Prot	Low
`Q9C758`	Arabidopsis thaliana	sp\|Q9C758\|TCP24_ARATH Transcription factor TCP24	68.900%	Swiss-Prot	Low
`Q10CE8`	Oryza sativa subsp. japonica	sp\|Q10CE8\|PCF6_ORYSJ Transcription factor PCF6	77.500%	Swiss-Prot	Low
`A2XMN1`	Oryza sativa subsp. indica	sp\|A2XMN1\|PCF6_ORYSI Transcription factor PCF6	77.500%	Swiss-Prot	Low
`A2ZMR9`	Oryza sativa subsp. indica	sp\|A2ZMR9\|PCF8_ORYSI Transcription factor PCF8	72.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card