LXL04_027506 | RubberDandelionOmics

Gene overview

LXL04_027506

Reference: OH-1004 Chr: Chr06 Coordinates: 17522461-17532991 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2085 bp · LXL04_027506|LXL04_027506|OH1004|cDNA

ATGGAGGTGGATGAAATTGAAAGACAGGTGAGTAAGTTTCAAAGGGTTGGTTCTAATGGTGATAATTCTTCAAACCCTCATAAGATAGCTACCCTGAGAGGGAATTTGGATGTACGAAACCTGGAGCATCGGTTTCCCGATGAGAAtggcggcggcggcggcggcggGGGTGGAGTTGTTGGGAGGCTTTGTGGATGGCCGTCGTCGCGGATCGTTAGGGTTTCTAGGGCTTCGGGTGGGAAGGATAGACACAGTAAGGT...

CDS

Download CDS FASTA

2085 bp · LXL04_027506|LXL04_027506|OH1004|CDS

ATGGAGGTGGATGAAATTGAAAGACAGGTGAGTAAGTTTCAAAGGGTTGGTTCTAATGGTGATAATTCTTCAAACCCTCATAAGATAGCTACCCTGAGAGGGAATTTGGATGTACGAAACCTGGAGCATCGGTTTCCCGATGAGAATGGCGGCGGCGGCGGCGGCGGGGGTGGAGTTGTTGGGAGGCTTTGTGGATGGCCGTCGTCGCGGATCGTTAGGGTTTCTAGGGCTTCGGGTGGGAAGGATAGACACAGTAAGGT...

Protein

Download Protein FASTA

694 aa · LXL04_027506|LXL04_027506|OH1004|PROTEIN

MEVDEIERQVSKFQRVGSNGDNSSNPHKIATLRGNLDVRNLEHRFPDENGGGGGGGGGVVGRLCGWPSSRIVRVSRASGGKDRHSKVLTSKGLRDRRVRLSVTTAIQFYDLQDRLGYDQPSKAVEWLIKAASSSISELPSLDPSFPGADGYNQHHHHNNQHQKQLSDEKKSTGNDNEFEDPNYQDNQQQNNTNNTNNNNVSVSKSSACSSTSETSKGSGLSLSRSENRVRARERARDMAAKKEKEKDGDPVRAAVVTQVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027506`
TK1151 ID	TkA07G068560
OH-1004 ID	LXL04_027506
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 97.624 / OH-1004 65.418 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027506

Location Chr06:17522461-17532991 (-)

Description Similar to TCP2: Transcription factor TCP2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18390`	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164).	TCP2 positively regulates HY5/HYH and photomorphogenesis in Arabidopsis.2016 · DOI: 10.1093/jxb/erv495
`At1g30210`	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164).	ABAP1 is a novel plant Armadillo BTB protein involved in DNA replication and transcription.2008 · DOI: 10.1038/emboj.2008.191

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0785800`	Transcription activator.	No verified direct reference in this release
`UniProt: A2XMN1`	Transcription activator.	No verified direct reference in this release
`UniProt: A2ZMR9`	Transcription activator.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027506 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009637 response to blue light Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048366 leaf development Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:2000306 positive regulation of photomorphogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G30210

ath:AT4G18390

dosa:Os03g0785800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.928

Rank 1 · LXL04_027506 · OH-1004

Cytoplasm0.128

Rank 2 · LXL04_027506 · OH-1004

Cell membrane0.034

Rank 3 · LXL04_027506 · OH-1004

Endoplasmic reticulum0.019

Rank 4 · LXL04_027506 · OH-1004

Plastid0.013

Rank 5 · LXL04_027506 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03634.20TCP79-245 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027506	`PF03634.20`	TCP	79	245	2.4e-40	139.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93V43`	Arabidopsis thaliana	Transcription factor TCP2	43.370%	Swiss-Prot	weak database homology
`Q9C758`	Arabidopsis thaliana	Transcription factor TCP24	40.896%	Swiss-Prot	weak database homology
`Q10CE8`	Oryza sativa subsp. japonica	Transcription factor PCF6	34.985%	Swiss-Prot	weak database homology
`A2XMN1`	Oryza sativa subsp. indica	Transcription factor PCF6	34.969%	Swiss-Prot	weak database homology
`A2ZMR9`	Oryza sativa subsp. indica	Transcription factor PCF8	70.732%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card