TkA07G068280 | RubberDandelionOmics

Gene overview

TkA07G068280

Reference: TK1151 Chr: Chr07 Coordinates: 17919535-17921542 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

780 bp · TkA07G068280|TK1151|cDNA

ATGGATTTTCAGGCCAGCGTAAGCCAAAATACAATTCCATCTGAGATTCCTTCTAGTGATCATGTCCCAATTGGAGTAAGTTCACATTCTCAAGAGTCATTACCTACACAAGAATCTGATGAAAATAGAAGATTACAAGCAAAGATAGCAAGAGCAAATAGGAAAATAGCATTGCAAATGAGTGCTGTTAGGAACACTAATCAATCAACAACATCATCTAGCAGAACTTCAAGAAAAACAAGTAAGAAAAGATCTTTAGA...

CDS

Download CDS FASTA

780 bp · TkA07G068280|TK1151|CDS

ATGGATTTTCAGGCCAGCGTAAGCCAAAATACAATTCCATCTGAGATTCCTTCTAGTGATCATGTCCCAATTGGAGTAAGTTCACATTCTCAAGAGTCATTACCTACACAAGAATCTGATGAAAATAGAAGATTACAAGCAAAGATAGCAAGAGCAAATAGGAAAATAGCATTGCAAATGAGTGCTGTTAGGAACACTAATCAATCAACAACATCATCTAGCAGAACTTCAAGAAAAACAAGTAAGAAAAGATCTTTAGA...

Protein

Download Protein FASTA

259 aa · TkA07G068280|TK1151|PROTEIN

MDFQASVSQNTIPSEIPSSDHVPIGVSSHSQESLPTQESDENRRLQAKIARANRKIALQMSAVRNTNQSTTSSSRTSRKTSKKRSLERNKDEDHNIFYTPDNMKLKVVVQKLLTSSDVGDQGRILLPKKEVEENLPGLATKEGVLIVMKEVFSYTEWRMKFRYWANHKGNIYLFDQCDDFIQKNLLEAGDQLNLYQDEQKNLYFTIKKKEIHTKEACDNYISERTEEEDYSLRILMEELKHKDEEEPITLTSLYNTCGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G068280`
TK1151 ID	TkA07G068280
OH-1004 ID	LXL04_027502
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G068280

Location Chr07:17919535-17921542 (-)

Description Similar to LEC2: B3 domain-containing transcription factor LEC2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28300`	Transcription regulator that plays a central role in embryo development.	LEAFY COTYLEDON2 encodes a B3 domain transcription factor that induces embryo development.2001 · DOI: 10.1073/pnas.201413498 Arabidopsis LEAFY COTYLEDON2 induces maturation traits and auxin activity: Implications for somatic embryogenesis.2008 · DOI: 10.1073/pnas.0712364105
`At3g24650`	Participates in abscisic acid-regulated gene expression during seed development.	A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation.2009 · DOI: 10.1105/tpc.108.062968 ABI3 controls embryo degreening through Mendel's I locus.2013 · DOI: 10.1073/pnas.1308114110

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0101000`	Transcription regulator involved in iron deficiency response and tolerance.	The transcription factor IDEF1 regulates the response to and tolerance of iron deficiency in plants.2007 · DOI: 10.1073/pnas.0707010104
`Os04g0676600`	Probable transcription regulator that binds specifically to the DNA sequence 5'-CATGC-3' of the IDE1 element found in the promoter of the barley iron deficiency-inducible gene IDS2.	No verified direct reference in this release
`UniProt: Q7XKC4`	Putative B3 domain-containing protein Os04g0676650.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027502 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009657 plastid organization Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010262 somatic embryogenesis Biological Process

GO:0010344 seed oilbody biogenesis Biological Process

GO:0010431 seed maturation Biological Process

GO:0010601 positive regulation of auxin biosynthetic process Biological Process

GO:0031930 mitochondria-nucleus signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G28300

ath:AT3G24650

dosa:Os01g0911700

dosa:Os08g0101000

zma:542523

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.942

Rank 1 · TkA07G068280 · TK1151

Cytoplasm0.147

Rank 2 · TkA07G068280 · TK1151

Cell membrane0.028

Rank 3 · TkA07G068280 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA07G068280 · TK1151

Mitochondrion0.013

Rank 5 · TkA07G068280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362B326-49 aa

PF00937CoV_nucleocap36-124 aa

PF31239At5g26805_C55-82 aa

PF31239At5g26805_C109-205 aa

PF02362B3110-209 aa

PF31239At5g26805_C208-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G068280	`PF02362`	B3	26	49	8.7e-11	42.4
TkA07G068280	`PF00937`	CoV_nucleocap	36	124	0.11	12.3
TkA07G068280	`PF31239`	At5g26805_C	55	82	0.0045	18.2
TkA07G068280	`PF31239`	At5g26805_C	109	205	0.0045	18.2
TkA07G068280	`PF02362`	B3	110	209	8.7e-11	42.4
TkA07G068280	`PF31239`	At5g26805_C	208	243	0.0045	18.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PFR7`	Arabidopsis thaliana	sp\|Q1PFR7\|LEC2_ARATH B3 domain-containing transcription factor LEC2	46.300%	Swiss-Prot	Low
`Q01593`	Arabidopsis thaliana	sp\|Q01593\|ABI3_ARATH B3 domain-containing transcription factor ABI3	40.900%	Swiss-Prot	Low
`Q6Z1Z3`	Oryza sativa subsp. japonica	sp\|Q6Z1Z3\|IDEF1_ORYSJ B3 domain-containing protein IDEF1	35.500%	Swiss-Prot	Low
`Q7XKC5`	Oryza sativa subsp. japonica	sp\|Q7XKC5\|IDEFH_ORYSJ B3 domain-containing protein Os04g0676600	37.800%	Swiss-Prot	Low
`Q7XKC4`	Oryza sativa subsp. japonica	sp\|Q7XKC4\|Y4765_ORYSJ Putative B3 domain-containing protein Os04g0676650	34.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card