TkA07G063780 | RubberDandelionOmics

Gene overview

TkA07G063780

Reference: TK1151 Chr: Chr07 Coordinates: 16885599-16887912 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1958 bp · TkA07G063780|TK1151|cDNA

TTTCGAACCCCTGCCACAAGCCTGATACCAACGAACCTATATATTAAAGGATCAAAAACCCTAGTAGACGAGAGTACAACCACGAGAAGAGACCCAATGACTTCGCCGGAGAAGCGATGCCTTTACGAAGTCCTTGGTCTCCCTCGCGATTGCAGCCCCGACGAGATCCGCTCGGCCTACAGAAAGCTCGCCCTCCAACGCCACCCGGACAAGCTAATCAAGTCCGGCGTTAGCGAAGCAGAAGCCACCGCTTCCTTCCA...

CDS

Download CDS FASTA

1164 bp · TkA07G063780|TK1151|CDS

TTTCGAACCCCTGCCACAAGCCTGATACCAACGAACCTATATATTAAAGGATCAAAAACCCTAGTAGACGAGAGTACAACCACGAGAAGAGACCCAATGACTTCGCCGGAGAAGCGATGCCTTTACGAAGTCCTTGGTCTCCCTCGCGATTGCAGCCCCGACGAGATCCGCTCGGCCTACAGAAAGCTCGCCCTCCAACGCCACCCGGACAAGCTAATCAAGTCCGGCGTTAGCGAAGCAGAAGCCACCGCTTCCTTCCA...

Protein

Download Protein FASTA

387 aa · TkA07G063780|TK1151|PROTEIN

FRTPATSLIPTNLYIKGSKTLVDESTTTRRDPMTSPEKRCLYEVLGLPRDCSPDEIRSAYRKLALQRHPDKLIKSGVSEAEATASFQELVNAYEVLSDVRERTWYDSHRSQILFSSSNSNKSSSGSAVVPDLMSFFSNSVYSGFSDKGKGFYKVYADVFDKIYRNELNFAKKLGLGDVVKEAPLMGNLDSPYAQVNAFYGYWLGFVTVMDFVWEDEYDATAGPNRKSRRLMEDENKKIRKKAKREYNETVRGLAEFVKKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G063780`
TK1151 ID	TkA07G063780
OH-1004 ID	LXL04_015275
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.700
Protein coverage (%)	TK1151 63.566 / OH-1004 53.611 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G063780

Location Chr07:16885599-16887912 (-)

Description Similar to JJJ1: DNAJ protein JJJ1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74250`	DNAJ protein JJJ1 homolog.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015275 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G74250

bta:509302

dre:336984

hsa:134218

mmu:78244

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.509

Rank 1 · TkA07G063780 · TK1151

Nucleus0.480

Rank 2 · TkA07G063780 · TK1151

Endoplasmic reticulum0.063

Rank 3 · TkA07G063780 · TK1151

Mitochondrion0.058

Rank 4 · TkA07G063780 · TK1151

Cell membrane0.052

Rank 5 · TkA07G063780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226DnaJ41-106 aa

PF21884ZUO1-like_ZHD151-264 aa

PF30210YKR005C_N160-172 aa

PF30210YKR005C_N219-260 aa

PF12269CpG_bind_C230-284 aa

PF30210YKR005C_N253-299 aa

PF12269CpG_bind_C267-358 aa

PF18868zf-C2H2_3rep291-350 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G063780	`PF00226`	DnaJ	41	106	2.7e-20	72.9
TkA07G063780	`PF21884`	ZUO1-like_ZHD	151	264	1e-21	78.2
TkA07G063780	`PF30210`	YKR005C_N	160	172	2.0	9.1
TkA07G063780	`PF30210`	YKR005C_N	219	260	2.0	9.1
TkA07G063780	`PF12269`	CpG_bind_C	230	284	9.9	6.5
TkA07G063780	`PF30210`	YKR005C_N	253	299	2.0	9.1
TkA07G063780	`PF12269`	CpG_bind_C	267	358	9.9	6.5
TkA07G063780	`PF18868`	zf-C2H2_3rep	291	350	0.11	13.9
TkA07G063780	`PF14871`	GHL6	293	332	0.0057	17.6
TkA07G063780	`PF30210`	YKR005C_N	315	371	2.0	9.1
TkA07G063780	`PF13824`	zf-Mss51	322	366	0.27	12.1
TkA07G063780	`PF26408`	DUF8106	325	350	0.28	11.7
TkA07G063780	`PF12756`	zf-C2H2_2	326	362	0.0097	16.8
TkA07G063780	`PF12171`	zf-C2H2_jaz	329	354	4.1e-11	43.5
TkA07G063780	`PF12874`	zf-met	329	353	6.3e-08	33.4
TkA07G063780	`PF25095`	C2H2-zf_KIN17	329	355	0.034	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C911`	Arabidopsis thaliana	sp\|Q9C911\|JJJ1_ARATH DNAJ protein JJJ1 homolog	69.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card