LXL04_015275 | RubberDandelionOmics

Gene overview

LXL04_015275

Reference: OH-1004 Chr: Chr03 Coordinates: 67390793-67395092 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1663 bp · LXL04_015275|LXL04_015275|OH1004|cDNA

ATGCTCCGTGCTCGTTGTCGGACATCCAAAACACCCAAAGCGCATCGGAAGCCAATCTAGCACAGCTTATCGATTTGTTCTTCCTCAACTAAACAGTCGATTCTCTACAGATGCCTTATCTGTTGAGTATAAAGCTGGGGAGATCGGCACTGTTTCCGGTATTCCCGAGGAACATCTTCAAAGGAGGGTTCTGATCTATTCACCAGCTCGAACAGCATCACAGCAAGGAGCAGGAAAAGTTGGAAAGTGGAAAATCAATT...

CDS

Download CDS FASTA

1374 bp · LXL04_015275|LXL04_015275|OH1004|CDS

TTGATGGGTTGGACTTCCACAGGGGATCCATATGCGAATGTTGGTGACTCTGCACTCACTTTTAAAACTGAAGCAGATGCAAAATCAATTGCAGAAAGACATGGTTGGAACTACACGAGTACATATGGTTTGTTATTTGATGCAGATCAAGAAGCACCCGACACCTCTAATGAAGGCAAAGGTATATTCAGACAACTTCAAATGGAAGGGACCTCCAAAAACAGCCGAGAACTAAAGGGCTCTCGTATTTGTGAAATAGC...

Protein

Download Protein FASTA

457 aa · LXL04_015275|LXL04_015275|OH1004|PROTEIN

MMGWTSTGDPYANVGDSALTFKTEADAKSIAERHGWNYTSTYGLLFDADQEAPDTSNEGKGIFRQLQMEGTSKNSRELKGSRICEIADNHGKRDPMTSPEKRCLYEVLGLPRDCSPDEIRSAYRKLALQRHPDKLIKSGVSEAEATASFQELVNAYEVLSDVRERTWYDSHRSQILFSNSNSDKSSSGSAVVPDLMSFSNSVYSGFSDKGKGFYKVYADVFDKIYRNELNFAKKLGLGDVVKEAPLMGNLDSPYAQVNAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015275`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015275

Location Chr03:67390793-67395092 (+)

Description Similar to JJJ1: DNAJ protein JJJ1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74250`	DNAJ protein JJJ1 homolog.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015275 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G74250

bta:509302

dre:336984

hsa:134218

mmu:78244

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.379

Rank 1 · LXL04_015275 · OH-1004

Nucleus0.376

Rank 2 · LXL04_015275 · OH-1004

Endoplasmic reticulum0.133

Rank 3 · LXL04_015275 · OH-1004

Mitochondrion0.126

Rank 4 · LXL04_015275 · OH-1004

Cell membrane0.111

Rank 5 · LXL04_015275 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04800.18NDUS41-39 aa

PF00226.37DnaJ104-169 aa

PF21884.3ZUO1-like_ZHD213-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015275	`PF04800.18`	NDUS4	1	39	3.3e-06	28.0
LXL04_015275	`PF00226.37`	DnaJ	104	169	5.1e-20	72.1
LXL04_015275	`PF21884.3`	ZUO1-like_ZHD	213	319	6.2e-19	69.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C911`	Arabidopsis thaliana	DNAJ protein JJJ1 homolog	70.796%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card