TkA07G063160 | RubberDandelionOmics

Gene overview

TkA07G063160

Reference: TK1151 Chr: Chr07 Coordinates: 16677152-16680054 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1589 bp · TkA07G063160|TK1151|cDNA

GGGCCACAAACGAAAAAAATGAACATAATCAGCAGTCAGCAAAAAACCGAAGCAGGGGCTTTTAAAGATTTCTTCATTCTGGTCGAATTCCTGCGCGAAAACAAACGAAGTGACAAAAAAACTTGCTGCTATGAAGAGGCGATGGTGGAGTAAATCAGCTCTAATATGTTATCGTATTCATCGTTTTTCTCTTCTTCTAGCAGGTCTCATGAATCCTTAATCCCCCTCCTCTTTCCCTCATAGAAGAGTTGTCGTCACTG...

CDS

Download CDS FASTA

477 bp · TkA07G063160|TK1151|CDS

ATGAACGGATTCCATTCAGACACTCAATCGTATACATTTGATCAATTGACTTCCAAAGTAGCTGGTATCGTACCGTCTGGTACCAATCCTGGCGAGTTCAACGAATCATCATGGCTCGATTCCAAGCATGGTAAATCAATGGCGAGGTTCATAAGCTACGCACTATGTGCTGCAGATGAAGCACTAAAGATTCAAACTGGATACCCTGTAACCAAGATGAAAAAGAGAAAACTGGTGTATCTATATAGGTGGGGAGGAAT...

Protein

Download Protein FASTA

158 aa · TkA07G063160|TK1151|PROTEIN

MNGFHSDTQSYTFDQLTSKVAGIVPSGTNPGEFNESSWLDSKHGKSMARFISYALCAADEALKIQTGYPVTKMKKRKLVYLYRWGGIGSISDILDASQLICEKKLRRLSPFFVPRILINMAAGHVSMKYGFQGPNHAAVHAMTACATGANSIGDAAKE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G063160`
TK1151 ID	TkA07G063160
OH-1004 ID	LXL04_038070
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.000
Protein coverage (%)	TK1151 99.367 / OH-1004 32.347 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G063160

Location Chr07:16677152-16680054 (-)

Description Similar to KAS: 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g04540`	Catalyzes all the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP.	Mitochondrial protein lipoylation does not exclusively depend on the mtKAS pathway of de novo fatty acid synthesis in Arabidopsis.2007 · DOI: 10.1104/pp.107.104000

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038070 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006637 acyl-CoA metabolic process Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0051790 short-chain fatty acid biosynthetic process Biological Process

GO:0051792 medium-chain fatty acid biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity Molecular Function

KEGG gene cross-reference

ath:AT2G04540

hsa:54995

mmu:71147

sme:SMc00574

spo:2541226

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.350

Rank 1 · TkA07G063160 · TK1151

Mitochondrion0.207

Rank 2 · TkA07G063160 · TK1151

Peroxisome0.160

Rank 3 · TkA07G063160 · TK1151

Extracellular0.110

Rank 4 · TkA07G063160 · TK1151

Nucleus0.103

Rank 5 · TkA07G063160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00109ketoacyl-synt17-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G063160	`PF00109`	ketoacyl-synt	17	156	4.8e-12	46.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L3X9`	Arabidopsis thaliana	sp\|Q8L3X9\|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial	62.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card