Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1269 bp · TkA07G053470|TK1151|cDNA
ATGAGAACTTTCACTATAACCACCGCCGTAACCTTTCTCCTCGTCCTCCTCCTGTACCCCACAGCCGCCGTCCCTACACCGCCACCAGACACCGTTCTTGCTCAATCGCCGTCGTCTTCTTCCACCTCCCCCACCCTTGACCCACACCAACTAAGAGCCCTTCAATTCCTCCACATCCCAACCACTCATGATCCCTGCAAACAATTCTCCTGCGACACCGCCGCCCCATTCCGCCACCTCCTCTCCCTCCGCCTCACCAG...
1269 bp · TkA07G053470|TK1151|CDS
ATGAGAACTTTCACTATAACCACCGCCGTAACCTTTCTCCTCGTCCTCCTCCTGTACCCCACAGCCGCCGTCCCTACACCGCCACCAGACACCGTTCTTGCTCAATCGCCGTCGTCTTCTTCCACCTCCCCCACCCTTGACCCACACCAACTAAGAGCCCTTCAATTCCTCCACATCCCAACCACTCATGATCCCTGCAAACAATTCTCCTGCGACACCGCCGCCCCATTCCGCCACCTCCTCTCCCTCCGCCTCACCAG...
Protein
Download Protein FASTA422 aa · TkA07G053470|TK1151|PROTEIN
MRTFTITTAVTFLLVLLLYPTAAVPTPPPDTVLAQSPSSSSTSPTLDPHQLRALQFLHIPTTHDPCKQFSCDTAAPFRHLLSLRLTSCSADLHLSTTLLSSVTTLTSLVFLNCHIPVVHFPTSLSTNLHSFTSINSLQRLTGVFLSRFHNLTHLYISGDPIKASGIHIITANMKSLKTITLTNTHLTGILPKDWNPNLTHVDFSKNKLKGTIPTSLTLLKNLKFLNFSSNNLIGVIPNSFGDLTSLQNVSLSSNSITGPI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G053470 |
|---|---|
| TK1151 ID | TkA07G053470 |
| OH-1004 ID | LXL04_027373 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 93.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G053470 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:14264542-14265810 (-) | |||||||||
| Description | Similar to RLP51: Receptor-like protein 51 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0007165 signal transduction Biological Process GO:0009617 response to bacterium Biological Process GO:0010074 maintenance of meristem identity Biological Process GO:0010078 maintenance of root meristem identity Biological Process GO:0010082 regulation of root meristem growth Biological Process GO:0010449 root meristem growth Biological Process GO:0031347 regulation of defense response Biological Process GO:1900426 positive regulation of defense response to bacterium Biological Process GO:1902290 positive regulation of defense response to oomycetes Biological Process GO:2000280 regulation of root development Biological Process GO:0005829 cytosol Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G78980 ath:AT4G18760 ath:AT5G45770 ath:AT5G48940 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12799LRR_448-59 aaPF13855LRR_850-59 aaPF23598LRR_1450-188 aaPF25019LRR_R13L1-DRL2174-109 aaPF00560LRR_180-89 aaPF13855LRR_892-102 aaPF13306LRR_597-140 aaPF20808MINT_RAM798-110 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G053470 | PF12799 | LRR_4 | 48 | 59 | 9.5e-13 | 48.7 |
| TkA07G053470 | PF13855 | LRR_8 | 50 | 59 | 1.2e-13 | 51.3 |
| TkA07G053470 | PF23598 | LRR_14 | 50 | 188 | 1e-08 | 35.1 |
| TkA07G053470 | PF25019 | LRR_R13L1-DRL21 | 74 | 109 | 2.2 | 8.9 |
| TkA07G053470 | PF00560 | LRR_1 | 80 | 89 | 1.5e-16 | 57.7 |
| TkA07G053470 | PF13855 | LRR_8 | 92 | 102 | 1.2e-13 | 51.3 |
| TkA07G053470 | PF13306 | LRR_5 | 97 | 140 | 1.0 | 10.0 |
| TkA07G053470 | PF20808 | MINT_RAM7 | 98 | 110 | 1.5 | 9.9 |
| TkA07G053470 | PF00560 | LRR_1 | 105 | 124 | 1.5e-16 | 57.7 |
| TkA07G053470 | PF23952 | LRR_EndoS | 126 | 206 | 0.00076 | 20.4 |
| TkA07G053470 | PF25019 | LRR_R13L1-DRL21 | 132 | 154 | 2.2 | 8.9 |
| TkA07G053470 | PF13855 | LRR_8 | 135 | 161 | 1.2e-13 | 51.3 |
| TkA07G053470 | PF12799 | LRR_4 | 135 | 161 | 9.5e-13 | 48.7 |
| TkA07G053470 | PF00560 | LRR_1 | 150 | 161 | 1.5e-16 | 57.7 |
| TkA07G053470 | PF12799 | LRR_4 | 150 | 189 | 9.5e-13 | 48.7 |
| TkA07G053470 | PF24141 | LRR_ComC | 171 | 215 | 7.6e-05 | 23.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.