LXL04_027373 | RubberDandelionOmics

Gene overview

LXL04_027373

Reference: OH-1004 Chr: Chr06 Coordinates: 14434581-14435849 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1269 bp · LXL04_027373|LXL04_027373|OH1004|cDNA

ATGAGAACTTTCACTATAACCACCGCCGTCACCTTTCTCCTCGTCCTCCTCCTATACCCCACAGCCGCCGTCCCTACACCGCCACCAGACACCGTTCCTGCTCAATCGCCGTCGTCTTCTTCCACTTCCTCCACCCTTGACCCACACCAACTAAGAGCCCTTCAATTCCTCCACATCCCAACCACTCACGATCCTTGCACACAATTCTCCTGCGACACCGCCACCCCATTCCGCCACCTCCTCTCCCTCCGCCTCACCAG...

CDS

Download CDS FASTA

1269 bp · LXL04_027373|LXL04_027373|OH1004|CDS

ATGAGAACTTTCACTATAACCACCGCCGTCACCTTTCTCCTCGTCCTCCTCCTATACCCCACAGCCGCCGTCCCTACACCGCCACCAGACACCGTTCCTGCTCAATCGCCGTCGTCTTCTTCCACTTCCTCCACCCTTGACCCACACCAACTAAGAGCCCTTCAATTCCTCCACATCCCAACCACTCACGATCCTTGCACACAATTCTCCTGCGACACCGCCACCCCATTCCGCCACCTCCTCTCCCTCCGCCTCACCAG...

Protein

Download Protein FASTA

422 aa · LXL04_027373|LXL04_027373|OH1004|PROTEIN

MRTFTITTAVTFLLVLLLYPTAAVPTPPPDTVPAQSPSSSSTSSTLDPHQLRALQFLHIPTTHDPCTQFSCDTATPFRHLLSLRLTSCSSDLHLSTTLLSSVTTLTSLVFLNCHIPVVHFPTSLSTNLHSFTSINSLQRLTGVFLSRFHNLTHLYISGDPIKASGIHIITANMKSLNTVTLSNTHLTGFLPKDWNPNLTHVDFSKNKLKGTIPTSLILLKNLKFLNFSSNNLIGVIPNSFGDLTSHQNVSLSSNSITGPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027373`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027373

Location Chr06:14434581-14435849 (-)

Description Similar to RLP51: Receptor-like protein 51

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18760`	Involved in plant defense.	Arabidopsis snc2-1D activates receptor-like protein-mediated immunity transduced through WRKY70.2010 · DOI: 10.1105/tpc.110.074120
`At5g45770`	Involved in plant defense.	No verified direct reference in this release
`At1g78980`	Protein STRUBBELIG-RECEPTOR FAMILY 5.	No verified direct reference in this release
`At5g48940`	Together with RGI1, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At2g42800`	Receptor like protein 29.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027373 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009617 response to bacterium Biological Process

GO:0010074 maintenance of meristem identity Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010449 root meristem growth Biological Process

GO:0031347 regulation of defense response Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

GO:1902290 positive regulation of defense response to oomycetes Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G78980

ath:AT4G18760

ath:AT5G45770

ath:AT5G48940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.694

Rank 1 · LXL04_027373 · OH-1004

Endoplasmic reticulum0.123

Rank 2 · LXL04_027373 · OH-1004

Cytoplasm0.091

Rank 3 · LXL04_027373 · OH-1004

Extracellular0.086

Rank 4 · LXL04_027373 · OH-1004

Nucleus0.064

Rank 5 · LXL04_027373 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_8196-256 aa

PF12799.14LRR_4196-233 aa

PF13855.13LRR_8248-304 aa

PF12799.14LRR_4270-303 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027373	`PF13855.13`	LRR_8	196	256	8.4e-12	45.4
LXL04_027373	`PF12799.14`	LRR_4	196	233	7.9e-11	42.6
LXL04_027373	`PF13855.13`	LRR_8	248	304	8.4e-12	45.4
LXL04_027373	`PF12799.14`	LRR_4	270	303	7.9e-11	42.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SN38`	Arabidopsis thaliana	Receptor-like protein 51	51.289%	Swiss-Prot	strong database homology
`Q9FK66`	Arabidopsis thaliana	Receptor-like protein 55	45.614%	Swiss-Prot	moderate database homology
`Q6R2K1`	Arabidopsis thaliana	Protein STRUBBELIG-RECEPTOR FAMILY 5	29.508%	Swiss-Prot	weak database homology
`C0LGV1`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI2	39.490%	Swiss-Prot	weak database homology
`Q9SJH6`	Arabidopsis thaliana	Receptor like protein 29	32.231%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card