TkA07G052890 | RubberDandelionOmics

Gene overview

TkA07G052890

Reference: TK1151 Chr: Chr07 Coordinates: 14086175-14087931 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1646 bp · TkA07G052890|TK1151|cDNA

CTGATTTGTAACTTTTTATAAGTTTATGGGCGAAAGGAAAACTTCATTTGGTATACTCCTGCGCCTAATTGTAGTATTGGGTAGTTTGTGTTCATCTCCTCTTGATGCGCCATGGAAATGGTGGAAGAAGGTAGAGTTCCCCCAAAACGAATACGATTTCAAGCAATCGTGGAGGAGGGGAAAGAAGATCGATTCAGTGCCTTGCCAGATTCCTTGCTTATTGAAATCCTCTCTCGCTTACCCTCCACAGAATACGCCAT...

CDS

Download CDS FASTA

1005 bp · TkA07G052890|TK1151|CDS

ATGGAAATGGTGGAAGAAGGTAGAGTTCCCCCAAAACGAATACGATTTCAAGCAATCGTGGAGGAGGGGAAAGAAGATCGATTCAGTGCCTTGCCAGATTCCTTGCTTATTGAAATCCTCTCTCGCTTACCCTCCACAGAATACGCCATTAGAACAGGTGCACTCTCCAAACGTTGTAAACACCTTTGGACTTTGGTTCCTACTCTAATTTTCAACCATTTGGCTGAAAATCCCCTCTGGTTCGATATCGTCGACAAAAC...

Protein

Download Protein FASTA

334 aa · TkA07G052890|TK1151|PROTEIN

MEMVEEGRVPPKRIRFQAIVEEGKEDRFSALPDSLLIEILSRLPSTEYAIRTGALSKRCKHLWTLVPTLIFNHLAENPLWFDIVDKTLTQCRQLKLKRFEVDTSYDIRFQSQVNDWIRYAIRCNVEELNLSLWSNGLKAEFLLDQSFFDCSFFTDLVLRGCIFNPIGAISWKSLHKLCIFDSKLDEDLIGNILSGSPLLETLELDSCYGFRLLDITSKSVKKLVLNGYNDPEDEIDLLADVIFINAPNVLSLSIQGNLLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G052890`
TK1151 ID	TkA07G052890
OH-1004 ID	LXL04_027362
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 76.782 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G052890

Location Chr07:14086175-14087931 (+)

Description Similar to At5g03100: F-box protein At5g03100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02910`	F-box/LRR-repeat protein At5g02910.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At4g13965`	Putative F-box/FBD/LRR-repeat protein At4g13965.	No verified direct reference in this release
`At2g26030`	F-box/FBD/LRR-repeat protein At2g26030.	No verified direct reference in this release
`At3g49030`	Putative F-box/FBD/LRR-repeat protein At3g49030.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027362 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT1G49610

ath:AT3G18150

ath:AT5G02920

ath:AT5G02930

ath:AT5G03100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.895

Rank 1 · TkA07G052890 · TK1151

Cytoplasm0.146

Rank 2 · TkA07G052890 · TK1151

Endoplasmic reticulum0.030

Rank 3 · TkA07G052890 · TK1151

Cell membrane0.028

Rank 4 · TkA07G052890 · TK1151

Plastid0.018

Rank 5 · TkA07G052890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box28-67 aa

PF12937F-box-like28-47 aa

PF12937F-box-like71-83 aa

PF23622LRR_At1g61320_AtMIF195-259 aa

PF24758LRR_At5g56370114-256 aa

PF00646F-box182-194 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G052890	`PF00646`	F-box	28	67	1.6e-05	25.3
TkA07G052890	`PF12937`	F-box-like	28	47	0.041	14.4
TkA07G052890	`PF12937`	F-box-like	71	83	0.041	14.4
TkA07G052890	`PF23622`	LRR_At1g61320_AtMIF1	95	259	6.5e-13	49.5
TkA07G052890	`PF24758`	LRR_At5g56370	114	256	2.2e-12	47.8
TkA07G052890	`PF00646`	F-box	182	194	1.6e-05	25.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYZ4`	Arabidopsis thaliana	sp\|Q9LYZ4\|FBL79_ARATH F-box/LRR-repeat protein At5g02910	31.500%	Swiss-Prot	Medium
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	30.700%	Swiss-Prot	Medium
`Q3EA38`	Arabidopsis thaliana	sp\|Q3EA38\|FDL48_ARATH Putative F-box/FBD/LRR-repeat protein At4g13965	29.000%	Swiss-Prot	Low
`Q8H1M0`	Arabidopsis thaliana	sp\|Q8H1M0\|FDL16_ARATH F-box/FBD/LRR-repeat protein At2g26030	27.100%	Swiss-Prot	Low
`Q9SMU0`	Arabidopsis thaliana	sp\|Q9SMU0\|FDL18_ARATH Putative F-box/FBD/LRR-repeat protein At3g49030	29.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card