TkA07G052650 | RubberDandelionOmics

Gene overview

TkA07G052650

Reference: TK1151 Chr: Chr07 Coordinates: 14007358-14008527 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · TkA07G052650|TK1151|cDNA

ATGAAGTTTGAAGAAACCGTGGAGAAGTGGCAAGAGGATCGAATAAGTACGTTGACAGATTGTTTGCTTCTTCAAATCCTCACTCGTTTACCCTCCACAAAAGAAGCCATTAGAACAGGTACGCTCTCCAAGCGATGGGAACATGTTTGGACTTCGATACATACTCTCATTTTCCAACATTACGAATCTTACGATAGCCTAAATCCATCTCGCACAAACCCTAACTCCATGTCCGATTTCGTCTCATTCGTGGACAAAAC...

CDS

Download CDS FASTA

1083 bp · TkA07G052650|TK1151|CDS

ATGAAGTTTGAAGAAACCGTGGAGAAGTGGCAAGAGGATCGAATAAGTACGTTGACAGATTGTTTGCTTCTTCAAATCCTCACTCGTTTACCCTCCACAAAAGAAGCCATTAGAACAGGTACGCTCTCCAAGCGATGGGAACATGTTTGGACTTCGATACATACTCTCATTTTCCAACATTACGAATCTTACGATAGCCTAAATCCATCTCGCACAAACCCTAACTCCATGTCCGATTTCGTCTCATTCGTGGACAAAAC...

Protein

Download Protein FASTA

360 aa · TkA07G052650|TK1151|PROTEIN

MKFEETVEKWQEDRISTLTDCLLLQILTRLPSTKEAIRTGTLSKRWEHVWTSIHTLIFQHYESYDSLNPSRTNPNSMSDFVSFVDKTLTQHRQSKLKKFVISTAYHTRFESQVNNWIHYAIRCDVEELDLSFSTLGLGVRFLLDQKFFTSSCFIDLKLSDCIFNPTGAISWTNLKKLCISGGTIDEDLIENILSGSPQLEILALIHCSGYRRLDITSKSVKYLMFGSYMAPDDRFHGNVIEINAPNIVYLTIQGSLILWK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G052650`
TK1151 ID	TkA07G052650
OH-1004 ID	LXL04_027357
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 99.167 / OH-1004 34.829 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G052650

Location Chr07:14007358-14008527 (+)

Description Similar to At5g03100: F-box protein At5g03100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22660`	F-box/FBD/LRR-repeat protein At5g22660.	No verified direct reference in this release
`At5g22700`	F-box/FBD/LRR-repeat protein At5g22700.	No verified direct reference in this release
`At4g26340`	F-box/FBD/LRR-repeat protein At4g26340.	No verified direct reference in this release
`At2g42730`	F-box/LRR-repeat protein At2g42730.	No verified direct reference in this release
`At3g60790`	F-box protein At3g60790.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027357 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT3G28410

ath:AT5G02700

ath:AT5G03100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.858

Rank 1 · TkA07G052650 · TK1151

Cytoplasm0.217

Rank 2 · TkA07G052650 · TK1151

Endoplasmic reticulum0.033

Rank 3 · TkA07G052650 · TK1151

Cell membrane0.030

Rank 4 · TkA07G052650 · TK1151

Plastid0.017

Rank 5 · TkA07G052650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622LRR_At1g61320_AtMIF111-60 aa

PF00646F-box15-53 aa

PF30495Chorismate_bind_242-115 aa

PF23622LRR_At1g61320_AtMIF188-268 aa

PF24758LRR_At5g56370114-252 aa

PF00646F-box186-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G052650	`PF23622`	LRR_At1g61320_AtMIF1	11	60	2.3e-18	67.5
TkA07G052650	`PF00646`	F-box	15	53	0.025	15.2
TkA07G052650	`PF30495`	Chorismate_bind_2	42	115	0.3	10.8
TkA07G052650	`PF23622`	LRR_At1g61320_AtMIF1	88	268	2.3e-18	67.5
TkA07G052650	`PF24758`	LRR_At5g56370	114	252	7.1e-13	49.4
TkA07G052650	`PF00646`	F-box	186	206	0.025	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNJ5`	Arabidopsis thaliana	sp\|Q9FNJ5\|FDL31_ARATH F-box/FBD/LRR-repeat protein At5g22660	24.100%	Swiss-Prot	Low
`Q9FNJ1`	Arabidopsis thaliana	sp\|Q9FNJ1\|FDL47_ARATH F-box/FBD/LRR-repeat protein At5g22700	28.900%	Swiss-Prot	Low
`Q8H1R7`	Arabidopsis thaliana	sp\|Q8H1R7\|FDL27_ARATH F-box/FBD/LRR-repeat protein At4g26340	23.400%	Swiss-Prot	Low
`Q0WR05`	Arabidopsis thaliana	sp\|Q0WR05\|FBL39_ARATH F-box/LRR-repeat protein At2g42730	26.500%	Swiss-Prot	Low
`Q9LZY4`	Arabidopsis thaliana	sp\|Q9LZY4\|FB213_ARATH F-box protein At3g60790	28.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card