LXL04_027357 | RubberDandelionOmics

Gene overview

LXL04_027357

Reference: OH-1004 Chr: Chr06 Coordinates: 14204588-14210795 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3078 bp · LXL04_027357|LXL04_027357|OH1004|cDNA

ATGGAAGCTGAGTTAGATTATACATTTATGGGGGTTTGGGAAACATTGCGTAAAGAAGAGATGCTTAAAGGATTTATACTAAATCTTGGCCATGTGAAGAAGCTCAAAATTGGGGTTTGTTGTTTTAAGAGGCTAAAGGCTTCATTTTTCCATCAAATTTGGAGTTTCCCGTTATCATCTGATAATGATTTGCTGGATCTTGGTGATTGGTCTGACATTGATTCACTTGAAAGTGGGGTTCGTTTGGATTATGCGGACCG...

CDS

Download CDS FASTA

3078 bp · LXL04_027357|LXL04_027357|OH1004|CDS

ATGGAAGCTGAGTTAGATTATACATTTATGGGGGTTTGGGAAACATTGCGTAAAGAAGAGATGCTTAAAGGATTTATACTAAATCTTGGCCATGTGAAGAAGCTCAAAATTGGGGTTTGTTGTTTTAAGAGGCTAAAGGCTTCATTTTTCCATCAAATTTGGAGTTTCCCGTTATCATCTGATAATGATTTGCTGGATCTTGGTGATTGGTCTGACATTGATTCACTTGAAAGTGGGGTTCGTTTGGATTATGCGGACCG...

Protein

Download Protein FASTA

1025 aa · LXL04_027357|LXL04_027357|OH1004|PROTEIN

MEAELDYTFMGVWETLRKEEMLKGFILNLGHVKKLKIGVCCFKRLKASFFHQIWSFPLSSDNDLLDLGDWSDIDSLESGVRLDYADRDRPRQQIAKLKAQALFGLCRPIFSRFQLIIVKDPNLKELKIPEGFDVRVYTETDILKVVGPSNKKERKKKLTLWLKEKGRKKKLCVVSVAERKGEEEEALPIYCEGIFVLNKRQDHLWRSGQNQSKTAPKKMKFEETVEKWQEDRISTLTDCLLLQILTRLPSTKEAIRTGTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027357`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027357

Location Chr06:14204588-14210795 (+)

Description Similar to At5g03100: F-box protein At5g03100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03100`	F-box protein At5g03100.	No verified direct reference in this release
`At3g28410`	Putative F-box/LRR-repeat protein At3g28410.	No verified direct reference in this release
`At5g02700`	Putative F-box/LRR-repeat protein At5g02700.	No verified direct reference in this release
`At5g02930`	Putative F-box/LRR-repeat protein At5g02930.	No verified direct reference in this release
`At1g49610`	Putative F-box protein At1g49610.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027357 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT3G28410

ath:AT5G02700

ath:AT5G03100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.835

Rank 1 · LXL04_027357 · OH-1004

Cytoplasm0.218

Rank 2 · LXL04_027357 · OH-1004

Cell membrane0.039

Rank 3 · LXL04_027357 · OH-1004

Endoplasmic reticulum0.029

Rank 4 · LXL04_027357 · OH-1004

Mitochondrion0.020

Rank 5 · LXL04_027357 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03214.20RGP103-151 aa

PF23622.2LRR_At1g61320_AtMIF1306-485 aa

PF24758.2LRR_At5g56370332-469 aa

PF00646.39F-box644-684 aa

PF23622.2LRR_At1g61320_AtMIF1725-895 aa

PF24758.2LRR_At5g56370741-880 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027357	`PF03214.20`	RGP	103	151	1.4e-10	41.6
LXL04_027357	`PF23622.2`	LRR_At1g61320_AtMIF1	306	485	9.8e-34	118.1
LXL04_027357	`PF24758.2`	LRR_At5g56370	332	469	3.5e-28	99.5
LXL04_027357	`PF00646.39`	F-box	644	684	1.6e-07	31.6
LXL04_027357	`PF23622.2`	LRR_At1g61320_AtMIF1	725	895	9.8e-34	118.1
LXL04_027357	`PF24758.2`	LRR_At5g56370	741	880	3.5e-28	99.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q501G5`	Arabidopsis thaliana	F-box protein At5g03100	32.087%	Swiss-Prot	weak database homology
`Q9LSJ3`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein At3g28410	30.294%	Swiss-Prot	weak database homology
`Q9LZ15`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein At5g02700	30.678%	Swiss-Prot	weak database homology
`Q9LYZ2`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein At5g02930	28.205%	Swiss-Prot	weak database homology
`Q9FX89`	Arabidopsis thaliana	Putative F-box protein At1g49610	28.152%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card