Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1332 bp · TkA07G048850|TK1151|cDNA
GGGCAAAGAAAAACTTGCTTTTGATACATAGACAGTCGGAAGAGGCGGGAAAATCATCAAAAACCCTAGTTCGGATTGAGCATCTGTCGTTCTTCTCTTGAATTGTACTTGATTTTCAATCAATCCACGCAAATGGGGATAAAGGGTTTAACGAAGCTTCTAGCGGACAATGCCCCAAAGGCCATGAAAGAGCAGAAATTCGAAAGTTACTTTGGTCGGAAAATCGCCATTGATGCTAGCATGAGCATCTACCAGTTTCT...
1191 bp · TkA07G048850|TK1151|CDS
ATGGGGATAAAGGGTTTAACGAAGCTTCTAGCGGACAATGCCCCAAAGGCCATGAAAGAGCAGAAATTCGAAAGTTACTTTGGTCGGAAAATCGCCATTGATGCTAGCATGAGCATCTACCAGTTTCTGATTGTTGTCGGACGAAGTGGGACAGAAATGCTGACCAATGAAGCGGGTGACGTGACTAGCCATTTGCAAGGTATGTTCAATCGGACAATTAGGCTTCTGGAATCTGGATTGAAGCCAGTTTATGTTTTTGA...
Protein
Download Protein FASTA397 aa · TkA07G048850|TK1151|PROTEIN
MGIKGLTKLLADNAPKAMKEQKFESYFGRKIAIDASMSIYQFLIVVGRSGTEMLTNEAGDVTSHLQGMFNRTIRLLESGLKPVYVFDGAPPDLKKQELAKRYSRREDATADLDEAIKAGNKEEIEKFSKRTVKVTRQHNEDCKKLLRLMGVPVIEAPSEAEAQCAALCKADKVYAVASEDMDSLTFGAPKFLRHLMDPASRKIPVMEFDVSKVLEELNLTMDQFIDLCILCGCDYCDSIRGIGGMTALKLIRQHGSIESI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G048850 |
|---|---|
| TK1151 ID | TkA07G048850 |
| OH-1004 ID | LXL04_027314 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.100 |
| Protein coverage (%) | TK1151 86.398 / OH-1004 93.989Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G048850 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:12987825-12996795 (-) | |||||||||
| Description | Similar to FEN1: Flap endonuclease 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. Rice
| |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006284 base-excision repair Biological Process GO:0043137 DNA replication, removal of RNA primer Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0003677 DNA binding Molecular Function GO:0008409 5'-3' exonuclease activity Molecular Function GO:0017108 5'-flap endonuclease activity Molecular Function GO:0048256 flap endonuclease activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT5G26680 dosa:Os05g0540100 gmx:100808044 osa:4339464 zma:732817 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00752XPG_N1-107 aaPF19040SGNH38-125 aaPF00752XPG_N120-134 aaPF02742Fe_dep_repr_C143-161 aaPF00867XPG_I150-234 aaPF013675_3_exonuc220-294 aaPF02742Fe_dep_repr_C245-264 aaPF02742Fe_dep_repr_C309-345 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G048850 | PF00752 | XPG_N | 1 | 107 | 3.7e-29 | 101.9 |
| TkA07G048850 | PF19040 | SGNH | 38 | 125 | 0.28 | 11.6 |
| TkA07G048850 | PF00752 | XPG_N | 120 | 134 | 3.7e-29 | 101.9 |
| TkA07G048850 | PF02742 | Fe_dep_repr_C | 143 | 161 | 0.26 | 12.0 |
| TkA07G048850 | PF00867 | XPG_I | 150 | 234 | 1.6e-32 | 112.4 |
| TkA07G048850 | PF01367 | 5_3_exonuc | 220 | 294 | 3.1e-07 | 31.5 |
| TkA07G048850 | PF02742 | Fe_dep_repr_C | 245 | 264 | 0.26 | 12.0 |
| TkA07G048850 | PF02742 | Fe_dep_repr_C | 309 | 345 | 0.26 | 12.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.