LXL04_027314 | RubberDandelionOmics

Gene overview

LXL04_027314

Reference: OH-1004 Chr: Chr06 Coordinates: 13278308-13281433 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1148 bp · LXL04_027314|LXL04_027314|OH1004|cDNA

GCGATTAGGGTTTAACGAAGCTTCTAGCGGACAATGCCCCAAAGGCCATGAAAGAGCAGAAATTCGAAAGTTACTTTGGTCGGAAAATCGCCATTGATGCTAGCATGAGCATCTACCAGTTTCTGATTGTTGTCGGACGAAGTGGGACAGAAATGCTGACCAATGAAGCGGGTGACGTGACTAGCCATTTGCAAGGTATGTTCAATCGGACAATTAGGCTTCTGGAATCTGGATTGAAGCCAGTTTATGTTTTTGATGGG...

CDS

Download CDS FASTA

1101 bp · LXL04_027314|LXL04_027314|OH1004|CDS

ATGAAAGAGCAGAAATTCGAAAGTTACTTTGGTCGGAAAATCGCCATTGATGCTAGCATGAGCATCTACCAGTTTCTGATTGTTGTCGGACGAAGTGGGACAGAAATGCTGACCAATGAAGCGGGTGACGTGACTAGCCATTTGCAAGGTATGTTCAATCGGACAATTAGGCTTCTGGAATCTGGATTGAAGCCAGTTTATGTTTTTGATGGGGCACCTCCTGATTTAAAGAAACAAGAACTTGCAAAACGATACTCAAG...

Protein

Download Protein FASTA

366 aa · LXL04_027314|LXL04_027314|OH1004|PROTEIN

MKEQKFESYFGRKIAIDASMSIYQFLIVVGRSGTEMLTNEAGDVTSHLQGMFNRTIRLLESGLKPVYVFDGAPPDLKKQELAKRYSRREDATADLDEAIKAGNKEEIEKFSKRTVKVTKQHNEDCKKLLRLMGVPVIEAPSEAEAQCAALCKADKVYAVASEDMDSLTFGAPKFLRHLMDPASRKIPVMEFDVSKVLEELNLTMDQFIDLCILCGCDYCDSIRGIGGMTALKLIRQHGSIESILENINKERYQIPEDWPY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027314`
TK1151 ID	TkA07G048850
OH-1004 ID	LXL04_027314
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 86.398 / OH-1004 93.989 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027314

Location Chr06:13278308-13281433 (-)

Description Similar to FEN1: Flap endonuclease 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26680`	Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0540100`	Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair.	No verified direct reference in this release
`UniProt: B8AW67`	Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027314 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006284 base-excision repair Biological Process

GO:0043137 DNA replication, removal of RNA primer Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0008409 5'-3' exonuclease activity Molecular Function

GO:0017108 5'-flap endonuclease activity Molecular Function

GO:0048256 flap endonuclease activity Molecular Function

KEGG gene cross-reference

ath:AT5G26680

dosa:Os05g0540100

gmx:100808044

osa:4339464

zma:732817

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.759

Rank 1 · LXL04_027314 · OH-1004

Cytoplasm0.271

Rank 2 · LXL04_027314 · OH-1004

Mitochondrion0.098

Rank 3 · LXL04_027314 · OH-1004

Cell membrane0.026

Rank 4 · LXL04_027314 · OH-1004

Endoplasmic reticulum0.016

Rank 5 · LXL04_027314 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00752.24XPG_N2-90 aa

PF00867.24XPG_I133-217 aa

PF01367.265_3_exonuc203-249 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027314	`PF00752.24`	XPG_N	2	90	1e-23	84.4
LXL04_027314	`PF00867.24`	XPG_I	133	217	1.3e-32	112.7
LXL04_027314	`PF01367.26`	5_3_exonuc	203	249	5.7e-07	30.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65251`	Arabidopsis thaliana	Flap endonuclease 1	81.967%	Swiss-Prot	strong database homology
`Q9SXQ6`	Oryza sativa subsp. japonica	Flap endonuclease 1-A	83.051%	Swiss-Prot	strong database homology
`B8AW67`	Oryza sativa subsp. indica	Flap endonuclease 1-A	83.051%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card