TkA07G047310 | RubberDandelionOmics

Gene overview

TkA07G047310

Reference: TK1151 Chr: Chr07 Coordinates: 12604673-12607567 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1980 bp · TkA07G047310|TK1151|cDNA

TGACTCAAACTTCGTAATTGATTTCAATTTTTAAGTTTGAAAAGAATATTAAAAGAACATTTCTGTCGTCGTATATATATTCCCCAAGGAACTTTTGGCGCCGAGTTGCAATTGACCACTGTGAGGCCAAGGGTAGCAAATTCTCTCTTTATGATCAAAAACCTTTCCAGATCTCCAATTCGTCCGGATCACAACATCAAGTCAAGTAACTATTGAAGGAAAGAGAGAGGGATTAGGTCATATTATTCACTTCTTCGAAT...

CDS

Download CDS FASTA

1287 bp · TkA07G047310|TK1151|CDS

ATGAGGAGAGGTGCAAAATCCCAGAGGAAATTCAAAGACAGGGCCATGAACCGCGTAGACGATCTTCAAAGCATGTTAATGGATCTGCAATCTGCAAGAAAGGAGAGCCGTAACATCGACATGGCTGTTCTCGAGGAACAAGTTCATCAAATGCTCAAGGAATGGAAAAAGGAACTCAACGAACCTTCACCCGCCCCTTCTTTACAACAGGGTGCAAGCTTAGGTTCTTTTTCTCCCGACATAAGTAAACTCCTGCAACT...

Protein

Download Protein FASTA

428 aa · TkA07G047310|TK1151|PROTEIN

MRRGAKSQRKFKDRAMNRVDDLQSMLMDLQSARKESRNIDMAVLEEQVHQMLKEWKKELNEPSPAPSLQQGASLGSFSPDISKLLQLYDEEDDATSGLPALKPDPDTQMCHPQGVNVNTSFGVNTQFDYNISFDMPRGYDQNCNDGVYGMWGEDNNYMPNICPPPSAFLGPKCALWDCPRPAQGWCSERVVQWWCTNYCSGLHATIAQHEGQAGMTPVIRPKGIELKDNLLFAALSAKAQGKTVGVPECEGAATAKSPWN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G047310`
TK1151 ID	TkA07G047310
OH-1004 ID	LXL04_010284
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	65.700
Protein coverage (%)	TK1151 97.664 / OH-1004 96.963 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G047310

Location Chr07:12604673-12607567 (+)

Description Similar to VOZ1: Transcription factor VOZ1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28520`	Transcriptional activator acting positively in the phytochrome B signaling pathway.	VOZ; isolation and characterization of novel vascular plant transcription factors with a one-zinc finger from Arabidopsis thaliana.2004 · DOI: 10.1093/pcp/pch101 The phytochrome-interacting vascular plant one-zinc finger1 and VOZ2 redundantly regulate flowering in Arabidopsis.2012 · DOI: 10.1105/tpc.112.101915
`At2g42400`	Transcriptional activator acting positively in the phytochrome B signaling pathway.	VOZ; isolation and characterization of novel vascular plant transcription factors with a one-zinc finger from Arabidopsis thaliana.2004 · DOI: 10.1093/pcp/pch101 The phytochrome-interacting vascular plant one-zinc finger1 and VOZ2 redundantly regulate flowering in Arabidopsis.2012 · DOI: 10.1105/tpc.112.101915

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010284 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G28520

ath:AT2G42400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.943

Rank 1 · TkA07G047310 · TK1151

Cytoplasm0.127

Rank 2 · TkA07G047310 · TK1151

Cell membrane0.043

Rank 3 · TkA07G047310 · TK1151

Endoplasmic reticulum0.034

Rank 4 · TkA07G047310 · TK1151

Plastid0.019

Rank 5 · TkA07G047310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10199Adaptin_binding13-48 aa

PF18517LZ3wCH15-48 aa

PF28235VOZ_N18-54 aa

PF24978Death_Lrrd130-65 aa

PF18517LZ3wCH117-129 aa

PF29201VOZ_C165-360 aa

PF02365NAM228-342 aa

PF10199Adaptin_binding368-388 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G047310	`PF10199`	Adaptin_binding	13	48	0.99	11.0
TkA07G047310	`PF18517`	LZ3wCH	15	48	0.2	12.4
TkA07G047310	`PF28235`	VOZ_N	18	54	1.7e-21	76.2
TkA07G047310	`PF24978`	Death_Lrrd1	30	65	0.091	13.7
TkA07G047310	`PF18517`	LZ3wCH	117	129	0.2	12.4
TkA07G047310	`PF29201`	VOZ_C	165	360	3.9e-109	363.3
TkA07G047310	`PF02365`	NAM	228	342	0.00039	21.6
TkA07G047310	`PF10199`	Adaptin_binding	368	388	0.99	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGQ0`	Arabidopsis thaliana	sp\|Q9SGQ0\|VOZ1_ARATH Transcription factor VOZ1	56.400%	Swiss-Prot	High
`Q9SLB9`	Arabidopsis thaliana	sp\|Q9SLB9\|VOZ2_ARATH Transcription factor VOZ2	46.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card